MIPOL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining in human prostate and skeletal muscle tissues using anti-MIPOL1 antibody. Corresponding MIPOL1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining of human prostate shows high expression.

Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining of human skeletal muscle shows low expression as expected.

Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MIPOL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MIPOL1 Antibody - BSA Free (NBP1-86161) is a polyclonal antibody validated for use in IHC and WB. Anti-MIPOL1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIPOL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MIPOL1 Protein (NBP1-86161PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MIPOL1 Antibody - BSA Free

• DKFZp313M2036
• MGC34010
• mirror-image polydactyly 1
• mirror-image polydactyly gene 1 protein

Background

MIPOL1, also known as Mirror-image polydactyly gene 1 protein, has 3 isoforms, a 442 amino acid isoform1 that is 51 kDa, a 261 amino acid isoform 2 that is 30 kDa and a short 169 amino acid isoform 3 that is 20 kDa; expressed very weakly in heart, liver, skeletal muscle, kidney, pancreas and fetal kidney; and may function as a tumor suppressor. Studies on this protein have shown a relationship with the following diseases and disorders: mirror-image polydactyly, Laurin-Sandrow syndrome, adult astrocytic tumour, fibular hypoplasia, intrahepatic cholangiocarcinoma, nasopharyngitis and carcinoma. This protein has shown an interaction with UBC protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MIPOL1 Antibody (NBP1-86161)(1)

Publication using NBP1-86161

• Cheung AK, Lung HL, Ko JM et al. Chromosome 14 transfer and functional studies identify a candidate tumor suppressor gene, mirror image polydactyly 1, in nasopharyngeal carcinoma. Proc Natl Acad Sci U S A 2009-08-01 [PMID: 19667180]

Bioinformatics

• Gene Symbol: MIPOL1