MIPOL1 Antibody

Images

 
Western Blot: MIPOL1 Antibody [NBP1-86161] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Orthogonal Strategies: Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining in human prostate and skeletal muscle tissues using anti-MIPOL1 antibody. Corresponding MIPOL1 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining of human prostate shows high expression.
Immunohistochemistry-Paraffin: MIPOL1 Antibody [NBP1-86161] - Staining of human skeletal muscle shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

MIPOL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KTAALVEEVYFAQKERDEAVMSRLQLAIEERDEAIARAKHMEMSLKVLENINPEENDMTLQELLNRINNADTGIAIQKNGAIIVDRIYKTKECKMRITAEEMSALIEERDAALSKCKRLEQELHHVKEQNQTSANNMRHLTAENNQ
Specificity
Specificity of human MIPOL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIPOL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MIPOL1 Protein (NBP1-86161PEP)
Publications
Read Publication using NBP1-86161.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIPOL1 Antibody

  • DKFZp313M2036
  • MGC34010
  • mirror-image polydactyly 1
  • mirror-image polydactyly gene 1 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-45354
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-82493
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81029
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB7557
Species: Hu
Applications: WB, IHC
NBP2-45861
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IF
NBP2-92773
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67484
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00005308-M01
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03198
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IF
NB110-57587
Species: Hu, Mu, Rt, Bv, Pm, Rb, Xp
Applications: WB, IHC, IHC-P, KD
NB300-576
Species: Hu, Mu, Rt, Ch, Gp, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB600-1397
Species: Hu, Mu, Bv, Ca, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, CyTOF-ready, Flow-IC

Publications for MIPOL1 Antibody (NBP1-86161)(1)

Reviews for MIPOL1 Antibody (NBP1-86161) (0)

There are no reviews for MIPOL1 Antibody (NBP1-86161). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIPOL1 Antibody (NBP1-86161) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MIPOL1 Products

Bioinformatics Tool for MIPOL1 Antibody (NBP1-86161)

Discover related pathways, diseases and genes to MIPOL1 Antibody (NBP1-86161). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIPOL1 Antibody (NBP1-86161)

Discover more about diseases related to MIPOL1 Antibody (NBP1-86161).
 

Pathways for MIPOL1 Antibody (NBP1-86161)

View related products by pathway.

PTMs for MIPOL1 Antibody (NBP1-86161)

Learn more about PTMs related to MIPOL1 Antibody (NBP1-86161).

Blogs on MIPOL1

There are no specific blogs for MIPOL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIPOL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIPOL1