MINPP1 Antibody

Images

 
Western Blot: MINPP1 Antibody [NBP1-82644] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-338
Immunohistochemistry-Paraffin: MINPP1 Antibody [NBP1-82644] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MINPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MINPP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MINPP1 Protein (NBP1-82644PEP)
Publications
Read Publication using NBP1-82644.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (82%). Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MINPP1 Antibody

  • EC 3.1.3.62
  • HIPER1
  • Inositol (13,4,5)-tetrakisphosphate 3-phosphatase
  • Ins(13,4,5)P(4) 3-phosphatase
  • MINPP2
  • MIPPDKFZp564L2016
  • multiple inositol polyphosphate histidine phosphatase, 1
  • multiple inositol polyphosphate phosphatase 1
  • multiple inositol polyphosphate phosphatase 2
  • multiple inositol-polyphosphate phosphatase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-86064
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-57999
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IP
NBP1-85965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71702
Species: Hu, Mu, Ch
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-76279
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-02939
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-83864
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86185
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-60642
Species: Hu
Applications: WB, IP
NBP2-14214
Species: Hu
Applications: IHC, IHC-P
NB600-713
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82644
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MINPP1 Antibody (NBP1-82644)(1)

Reviews for MINPP1 Antibody (NBP1-82644) (0)

There are no reviews for MINPP1 Antibody (NBP1-82644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MINPP1 Antibody (NBP1-82644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MINPP1 Products

Bioinformatics Tool for MINPP1 Antibody (NBP1-82644)

Discover related pathways, diseases and genes to MINPP1 Antibody (NBP1-82644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MINPP1 Antibody (NBP1-82644)

Discover more about diseases related to MINPP1 Antibody (NBP1-82644).
 

Pathways for MINPP1 Antibody (NBP1-82644)

View related products by pathway.

PTMs for MINPP1 Antibody (NBP1-82644)

Learn more about PTMs related to MINPP1 Antibody (NBP1-82644).

Blogs on MINPP1

There are no specific blogs for MINPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MINPP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MINPP1