Recombinant Human Mindin/Spondin-2 GST (N-Term) Protein

SDS-Page: Recombinant Human Mindin/Spondin-2 Protein [H00010417-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human Mindin/Spondin-2 GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 27-331 of Human SPON2
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: QPLGGESICSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMWRKNQYVSNGLRDFAERGEAWALMKEIEAAGEALQSAHEVFSAPAVPSGTGQTSAELEVQRRHSLVSFVVRIVPSPDWFVGVDSLDLCDGDRWREQAALDLYPYDAGTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARVTLLRLRQSPRAFIPPAPVLPSRDNEIVDSASVPETPLDCEVSLWSSWGLCGGHCGRLGTKSRTRYVRVQPANNGSPCPELEEEAECVPDNCV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: SPON2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 59.29 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mindin/Spondin-2 GST (N-Term) Protein

• Differentially expressed in cancerous and non-cancerous lung cells 1
• DIL1
• DIL-1
• DIL1FLJ34460
• DKFZp686G21139
• FLJ16313
• FLJ22401
• Mindin
• M-SPONDIN
• RG-1
• SPON2
• Spondin 2
• spondin 2, extracellular matrix protein
• spondin-2

Background

SPON2( AAH36341, 27 a.a. - 332 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Publications for Mindin/Spondin-2 Recombinant Protein (H00010417-P01)(1)

Publication using H00010417-P01

• Qian X, Li C, Pang B et al. Spondin-2 (SPON2), a More Prostate-Cancer-Specific Diagnostic Biomarker. PLoS One 2012-05-15 [PMID: 22615945]

FAQs for Mindin/Spondin-2 Recombinant Protein (H00010417-P01). (Showing 1 - 1 of 1 FAQ).

1. I am interested in ordering: Rec. Human Spondin-2 (H00010417-P01-10ug). Can you investigate what concentrationis the existing lot? I'd rather have more than 100 ug / ml.
   • The concentration of Lot 1001111 is 0.19mg/ml and of Lot 10106B9 it is 0.15mg/ml.

Bioinformatics

• Gene Symbol: SPON2