Migfilin Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Migfilin Antibody [NBP2-57310] - Staining of human cell line A-431 shows localization to nucleoli fibrillar center & cell junctions.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Migfilin Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SKPEKRVASSVFITLAPPRRDVAVAEEVRQAVCEARRGRPWEAPAPMKTPEAGLAGRPSPWTTPGRAAATVPAAPMQLFNGGCPPPPPVLDGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FBLIM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Migfilin Recombinant Protein Antigen (NBP2-57310PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Migfilin Antibody - BSA Free

• CAL
• DKFZp434G171
• FBLP-1FBLP1CSX-associated LIM
• filamin binding LIM protein 1
• filamin-binding LIM protein 1
• filamin-binding LIM protein-1
• MIG2-interacting protein
• migfilin
• mitogen-inducible 2 interacting protein
• Mitogen-inducible 2-interacting protein

Background

FBLIM1 encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Migfilin Antibody (NBP2-57310)(1)

Publication using NBP2-57310

• Indra I, Troyanovsky RB, Shapiro L et al. Sensing Actin Dynamics through Adherens Junctions Cell Rep 2020-02-25 [PMID: 32101754] (ICC/IF, Human)
  
  Details:
  A431 cell line

Bioinformatics

• Gene Symbol: FBLIM1