Home » Migfilin » Migfilin Antibodies » Migfilin Antibody (5E11)

Migfilin Antibody (5E11)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Migfilin Antibody (5E11) [H00054751-M10] - Analysis of FBLIM1 expression in HepG2 (Cat # L019V1).
Western Blot: Migfilin Antibody (5E11) [H00054751-M10] - Analysis of FBLIM1 expression in HepG2 (Cat # L019V1).
Western Blot: Migfilin Antibody (5E11) [H00054751-M10] - Analysis of FBLIM1 expression in transfected 293T cell line by FBLIM1 monoclonal antibody (M10), clone 5E11. Lane 1: FBLIM1 transfected lysatE (41 KDa). Lane 2: ...read more
ELISA: Migfilin Antibody (5E11) [H00054751-M10] - Detection limit for recombinant GST tagged FBLIM1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Migfilin Antibody (5E11) Summary

Immunogen
FBLIM1 (NP_060026, 270 a.a. ~ 373 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHVKRSAAGCC
Specificity
FBLIM1 - filamin binding LIM protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBLIM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate, transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Publications
Read Publication using H00054751-M10.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Migfilin Antibody (5E11)

  • CAL
  • DKFZp434G171
  • FBLP-1FBLP1CSX-associated LIM
  • filamin binding LIM protein 1
  • filamin-binding LIM protein 1
  • filamin-binding LIM protein-1
  • MIG2-interacting protein
  • migfilin
  • mitogen-inducible 2 interacting protein
  • Mitogen-inducible 2-interacting protein

Background

This gene encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HPD Antibody
NBP1-89366
Western Blot: HPD Antibody [NBP1-89366] - Analysis in mouse liver tissue and rat liver tissue.
Western Blot: HPD Antibody [NBP1-89366] - Analysis using Anti-HPD antibody NBP1-89366 (A) shows similar pattern to independent antibody NBP2-32657 (B).
Immunohistochemistry-Paraffin: HPD Antibody [NBP1-89366] - Analysis in human liver and endometrium tissues. Corresponding HPD RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of GNAI1 expression in transfected 293T cell line by GNAI1 monoclonal antibody (M01), clone 2B8-2A5.Lane 1: GNAI1 transfected lysate(40.4 KDa).Lane 2: Non-transfected lysate.
Immunohistochemistry-Paraffin: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Analysis of monoclonal antibody to GNAI1 on formalin-fixed paraffin-embedded human tonsil. Antibody concentration 3 ug/ml.
Sandwich ELISA: G protein alpha inhibitor 1 Antibody (2B8-2A5) [H00002770-M01] - Detection limit for recombinant GST tagged GNAI1 is approximately 1ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
VSX1 Antibody
NBP3-10377
Western Blot: VSX1 Antibody [NBP3-10377] - Western blot analysis using NBP3-10377 on Human Liver as a positive control. Antibody Titration: 0.2-1 ug/ml
Species: Hu
Applications: WB
S Opsin Antibody -
Azide and BSA Free
NBP1-20194
Immunohistochemistry-Paraffin: S Opsin Antibody [NBP1-20194] - Sections of mouse eye. HIER: Tris-EDTA, pH 9 for 20 min using Thermo PT Module.Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. dilution 1: 500, incubated 30 min at RT using Autostainer. Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: S Opsin Antibody [NBP1-20194] - Sections of mouse eye. Tris-EDTA, pH 9 for 20 min using Thermo PT Module. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um. dilution 1: 500, incubated 30 min at RT using Autostainer. Sections were counterstained with Harris Hematoxylin.
Western Blot: S Opsin Antibody [NBP1-20194] - WB on tissue lysates. Blocking with 1% LFDM for 30 min at RT; Primary antibody used at 1:500 dilution, incubated overnight at 4C.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EYA1 Antibody
NBP2-87382
Immunohistochemistry: EYA1 Antibody [NBP2-87382] - Immunohistochemistry with Human kidney lysate tissue at an antibody concentration of 5.0ug/ml using anti-EYA1 antibody
Western Blot: EYA1 Antibody [NBP2-87382] - WB Suggested Anti-EYA1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Human brain
Western Blot: EYA1 Antibody [NBP2-87382] - Host: Rabbit. Target Name: EYA1. Sample Tissue: Human MCF7 Whole Cell. Antibody Dilution: 1ug/ml
Species: Hu
Applications: IHC, IHC-P, WB
SmyD1 Antibody
NBP2-20428
Western Blot: SmyD1 Antibody [NBP2-20428] - Sample (30 ug of whole cell lysate) A: 293T B: A431 7. 5% SDS PAGE gel, diluted at 1:10000.
Western Blot: SmyD1 Antibody [NBP2-20428] - Sample (50 ug of whole cell lysate) A: Mouse Heart, 7. 5% SDS PAGE gel, diluted at 1:10000.
Immunohistochemistry-Paraffin: SmyD1 Antibody [NBP2-20428] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
UCN2 Antibody
NBP3-12450
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse colon. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 5x magnification.
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse colon. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 40 magnification.
Immunohistochemistry-Paraffin: UCN2 Antibody [NBP3-12450] - Mouse liver. 1:1000 dilution in IHC blocking buffer. DAB (brown) staining in Hematoxylin QS (blue) counterstain. 5X magnification.
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, SB, WB
Emerin Antibody
NBP1-87692
Immunohistochemistry-Paraffin: Emerin Antibody [NBP1-87692] - Staining of human skeletal muscle shows moderate nuclear membrane positivity in myocytes.
Immunocytochemistry/Immunofluorescence: Emerin Antibody [NBP1-87692] - Staining of human cell line U-251 MG shows localization to nuclear membrane & endoplasmic reticulum. Antibody staining is shown in green.
Western Blot: Emerin Antibody [NBP1-87692] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
(5 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(718 Publications)
Species: Hu
Applications: BA
GCFC2 Antibody
H00006936-B01P
Western Blot: GCFC2 Antibody [H00006936-B01P] - Analysis of C2orf3 expression in transfected 293T cell line by C2orf3 polyclonal antibody. Lane 1: C2orf3 transfected lysate(23.76 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: GCFC2 Antibody [H00006936-B01P] - Analysis of purified antibody to C2orf3 on HeLa cell. (antibody concentration 10 ug/ml)
Species: Hu
Applications: ICC/IF, WB
C-Reactive
Protein/CRP [HRP]
DCRP00
(4 Reviews)
(126 Publications)
Species: Hu
Applications: ELISA
Glutathione
Reductase Antibody
NBP2-76932
Western Blot: Glutathione Reductase Antibody [NBP2-76932] - Western blot analysis of GLUR on different lysates using anti-GLUR antibody at 1/2,000 dilution.Positive control:Lane1: A549 Lane2: Rat liver tissue
Immunocytochemistry/Immunofluorescence: Glutathione Reductase Antibody [NBP2-76932] - ICC staining GLUR in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Glutathione Reductase Antibody [NBP2-76932] - Immunohistochemical analysis of paraffin-embedded rat epididymis tissue using anti-GLUR antibody. Counter stained with hematoxylin.
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin was detected in immersion fixed BG01V human embryonic stem cells differentiated to hepatocytes using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. Cells were co-stained using Sheep Anti-Human CEBP alpha (Catalog # AF7094) and NorthernLights™ 493-conjugated Anti-Sheep IgG Secondary Antibody (green, Catalog # NL012). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Albumin was detected in immersion fixed paraffin-embedded sections of human liver using Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) at 0.1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Mouse IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC001). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
(5 Reviews)
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-6 [HRP]
D6050
(32 Reviews)
(636 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunohistochemistry of paraffin-embedded human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for Migfilin Antibody (H00054751-M10)(1)


Reviews for Migfilin Antibody (H00054751-M10) (0)

There are no reviews for Migfilin Antibody (H00054751-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Migfilin Antibody (H00054751-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Migfilin Products

Bioinformatics Tool for Migfilin Antibody (H00054751-M10)

Discover related pathways, diseases and genes to Migfilin Antibody (H00054751-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Migfilin Antibody (H00054751-M10)

Discover more about diseases related to Migfilin Antibody (H00054751-M10).
 

Pathways for Migfilin Antibody (H00054751-M10)

View related products by pathway.

PTMs for Migfilin Antibody (H00054751-M10)

Learn more about PTMs related to Migfilin Antibody (H00054751-M10).

Blogs on Migfilin

There are no specific blogs for Migfilin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Migfilin Antibody (5E11) and receive a gift card or discount.


Bioinformatics

Gene Symbol FBLIM1
Entrez
OMIM
Uniprot