Microseminoprotein, Prostate Associated Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Microseminoprotein, Prostate Associated Antibody [NBP2-30630] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: Microseminoprotein, Prostate Associated Antibody [NBP2-30630] - Staining of human prostate shows strong cytoplasmic positivity, with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Microseminoprotein, Prostate Associated Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FTLGESWLRKDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSMP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Microseminoprotein, Prostate Associated Protein (NBP2-30630PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Microseminoprotein, Prostate Associated Antibody

  • MSMP
  • PC3 Prostate Cancer Cell-Secreted Microprotein
  • PC3-Secreted Microprotein
  • Prostate-Associated Microseminoprotein
  • PSMP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83443
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00814
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
H00005498-M01
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82432
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-15142
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38512
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5430
Species: Mu
Applications: WB, IP
H00084941-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30630
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Microseminoprotein, Prostate Associated Antibody (NBP2-30630) (0)

There are no publications for Microseminoprotein, Prostate Associated Antibody (NBP2-30630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Microseminoprotein, Prostate Associated Antibody (NBP2-30630) (0)

There are no reviews for Microseminoprotein, Prostate Associated Antibody (NBP2-30630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Microseminoprotein, Prostate Associated Antibody (NBP2-30630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Microseminoprotein, Prostate Associated Products

Bioinformatics Tool for Microseminoprotein, Prostate Associated Antibody (NBP2-30630)

Discover related pathways, diseases and genes to Microseminoprotein, Prostate Associated Antibody (NBP2-30630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Microseminoprotein, Prostate Associated Antibody (NBP2-30630)

Discover more about diseases related to Microseminoprotein, Prostate Associated Antibody (NBP2-30630).

Blogs on Microseminoprotein, Prostate Associated

There are no specific blogs for Microseminoprotein, Prostate Associated, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Microseminoprotein, Prostate Associated Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSMP
Uniprot