MgcRacGAP/RACGAP1 Antibody - BSA Free

Western Blot: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-RACGAP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

Immunocytochemistry/Immunofluorescence: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human cell line MCF7 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human Placenta shows strong nuclear positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining in human testis and endometrium tissues using anti-RACGAP1 antibody. Corresponding RACGAP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Analysis in human testis and pancreas tissues using NBP2-47374 antibody. Corresponding RACGAP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human Lymph node shows moderate nuclear positivity in germinal center and non-germinal center cells.

Immunohistochemistry-Paraffin: MgcRacGAP/RACGAP1 Antibody [NBP2-47374] - Staining of human Pancreas shows no nuclear positivity in exocrine glandular cells as expected.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MgcRacGAP/RACGAP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MgcRacGAP/RACGAP1 Antibody - BSA Free (NBP2-47374) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SALAFLNRGQPSSSNAGNKRLSTIDESGSILSDISFDKTDESLDWDSSLVKTFKLKKREKRRSTSRQFVDGPPGPVKKTRSIGSAVDQGNESIVAKTTVTVPNDGGPIEAVSTIET
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: RACGAP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
  • Western Blot 1:100 - 1:250
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MgcRacGAP/RACGAP1 Protein (NBP2-47374PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MgcRacGAP/RACGAP1 Antibody - BSA Free

• GTPase activating protein
• HsCYK-4
• ID-GAP
• KIAA1478
• Male germ cell RacGap
• MgcRacGAP
• MgcRacGAPrac GTPase-activating protein 1
• Rac GTPase activating protein 1
• RACGAP1

Background

Rho GTPases control a variety of cellular processes. There are 3 subtypes of Rho GTPases in the Ras superfamily of small G proteins: RHO (see MIM 165370), RAC (see RAC1; MIM 602048), and CDC42 (MIM 116952). GTPase-activating proteins (GAPs) bind activated forms of Rho GTPases and stimulate GTP hydrolysis. Through this catalytic function, Rho GAPs negatively regulate Rho-mediated signals. GAPs may also serve as effector molecules and play a role in signaling downstream of Rho and other Ras-like GTPases.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: RACGAP1