MFAP4 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MFAP4 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFAP4.
  
  

  Source: E. coli

  Amino Acid Sequence: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTT

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MFAP4
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30439.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MFAP4 Recombinant Protein Antigen

• MFAP4
• MFAP-4
• microfibril-associated glycoprotein 4
• microfibrillar-associated protein 4

Background

MFAP4, also known as Microfibril-associated glycoprotein 4, has 2 isoforms, a 255 amino acid short isoform that is 29 kDa and a long 297 amino acid isoforms that is 33 kDa, binding specificities for both collagen and carbohydrate, and it is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The protein is being studied for its involvement in smith-magenis syndrome, intracranial aneurysm, liver cirrhosis, and ovarian cancer. MFAP4 protein involvement has been observed with relation to SFTPD and HDAC1 in molecules associated with elastic fibres, extracellular matrix organization, and elastic fibre formation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MFAP4