Methionine Sulfoxide Reductase A Antibody

Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Analysis in human cell line WM-115.

Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & actin filaments.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Methionine Sulfoxide Reductase A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRA
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: WB reported in scientific literature (PMID: 25341044). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Methionine Sulfoxide Reductase A Protein (NBP1-87456PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Methionine Sulfoxide Reductase A Antibody

• cytosolic methionine-S-sulfoxide reductase
• EC 1.8.4.11
• methionine sulfoxide reductase A
• peptide met (O) reductase
• Peptide Met(O) reductase
• peptide methionine sulfoxide reductase
• Peptide-methionine (S)-S-oxide reductase
• PMSR
• Protein-methionine-S-oxide reductase

Background

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)(1)

Publication using NBP1-87456

• Shin Sh, Yoon H, Chun Ys et al. Arrest defective 1 regulates the oxidative stress response in human cells and mice by acetylating methionine sulfoxide reductase A. Cell Death Dis. 2014-10-24 [PMID: 25341044] (WB, Human)

Bioinformatics

• Gene Symbol: MSRA