Methionine Sulfoxide Reductase A Antibody

Images

 
Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytosol & actin filaments.
Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methionine Sulfoxide Reductase A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Specificity
Specificity of human Methionine Sulfoxide Reductase A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSRA
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
WB reported in scientific literature (PMID: 25341044). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Methionine Sulfoxide Reductase A Protein (NBP1-87456PEP)
Publications
Read Publication using
NBP1-87456 in the following applications:

  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Methionine Sulfoxide Reductase A Antibody

  • cytosolic methionine-S-sulfoxide reductase
  • EC 1.8.4.11
  • methionine sulfoxide reductase A
  • peptide met (O) reductase
  • Peptide Met(O) reductase
  • peptide methionine sulfoxide reductase
  • Peptide-methionine (S)-S-oxide reductase
  • PMSR
  • Protein-methionine-S-oxide reductase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051734-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
H00055697-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NB110-60935
Species: Hu, Mu, Ch, Pm
Applications: WB, IB, IHC
NBP1-84259
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-92090
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-38370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87456
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Methionine Sulfoxide Reductase A Antibody (NBP1-87456) (0)

There are no reviews for Methionine Sulfoxide Reductase A Antibody (NBP1-87456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Methionine Sulfoxide Reductase A Antibody (NBP1-87456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Methionine Sulfoxide Reductase A Products

Bioinformatics Tool for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)

Discover related pathways, diseases and genes to Methionine Sulfoxide Reductase A Antibody (NBP1-87456). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)

Discover more about diseases related to Methionine Sulfoxide Reductase A Antibody (NBP1-87456).
 

Pathways for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)

View related products by pathway.

PTMs for Methionine Sulfoxide Reductase A Antibody (NBP1-87456)

Learn more about PTMs related to Methionine Sulfoxide Reductase A Antibody (NBP1-87456).

Blogs on Methionine Sulfoxide Reductase A

There are no specific blogs for Methionine Sulfoxide Reductase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionine Sulfoxide Reductase A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSRA