Western Blot: Methionine Sulfoxide Reductase A Antibody [NBP1-87456] - Analysis in human cell line WM-115.
Immunohistochemistry-Paraffin-Methionine Sulfoxide Reductase A Antibody-NBP1-87456- Staining of human kidney shows strong nuclear and cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin-Methionine Sulfoxide Reductase A Antibody-NBP1-87456-Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin-Methionine Sulfoxide Reductase A Antibody-NBP1-87456-Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin-Methionine Sulfoxide Reductase A Antibody-NBP1-87456-Staining of human skeletal muscle shows no positivity in myocytes as expected.
Methionine Sulfoxide Reductase A Antibody - BSA Free Summary
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSRA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (84%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for Methionine Sulfoxide Reductase A Antibody - BSA Free
cytosolic methionine-S-sulfoxide reductase
EC 1.8.4.11
methionine sulfoxide reductase A
peptide met (O) reductase
Peptide Met(O) reductase
peptide methionine sulfoxide reductase
Peptide-methionine (S)-S-oxide reductase
PMSR
Protein-methionine-S-oxide reductase
Background
This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Methionine Sulfoxide Reductase A Antibody (NBP1-87456) (0)
There are no reviews for Methionine Sulfoxide Reductase A Antibody (NBP1-87456).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Methionine Sulfoxide Reductase A Antibody - BSA Free and receive a gift card or discount.