Methionine Sulfoxide Reductase A Antibody

Images

 
Western Blot: Methionine Sulfoxide Reductase A Antibody [H00004482-B01P] - Analysis of MSRA expression in human liver.
Western Blot: Methionine Sulfoxide Reductase A Antibody [H00004482-B01P] - Analysis of MSRA expression in transfected 293T cell line by MSRA polyclonal antibody. Lane 1: MSRA transfected lysate(25.85 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Methionine Sulfoxide Reductase A Antibody Summary

Immunogen
MSRA (NP_036463.1, 1 a.a. - 235 a.a.) full-length human protein. MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MSRA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Methionine Sulfoxide Reductase A Antibody

  • cytosolic methionine-S-sulfoxide reductase
  • EC 1.8.4.11
  • methionine sulfoxide reductase A
  • peptide met (O) reductase
  • Peptide Met(O) reductase
  • peptide methionine sulfoxide reductase
  • Peptide-methionine (S)-S-oxide reductase
  • PMSR
  • Protein-methionine-S-oxide reductase

Background

This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86594
Species: Hu
Applications: WB, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-57749
Species: Hu
Applications: WB, IHC
NBP2-13731
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051734-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB110-60935
Species: Hu, Mu, Pm
Applications: WB
NBP1-84259
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NBP1-92090
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5724
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
H00004482-B01P
Species: Hu
Applications: WB

Publications for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P) (0)

There are no publications for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P) (0)

There are no reviews for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Methionine Sulfoxide Reductase A Products

Bioinformatics Tool for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P)

Discover related pathways, diseases and genes to Methionine Sulfoxide Reductase A Antibody (H00004482-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P)

Discover more about diseases related to Methionine Sulfoxide Reductase A Antibody (H00004482-B01P).
 

Pathways for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P)

View related products by pathway.

PTMs for Methionine Sulfoxide Reductase A Antibody (H00004482-B01P)

Learn more about PTMs related to Methionine Sulfoxide Reductase A Antibody (H00004482-B01P).

Blogs on Methionine Sulfoxide Reductase A

There are no specific blogs for Methionine Sulfoxide Reductase A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionine Sulfoxide Reductase A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSRA
Uniprot