Recombinant Human Metaxin-2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Metaxin-2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 154-252 of Human Metaxin-2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: EVKRKMKAIGWGKKTLDQVLEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTNDELSEKVKNYSNLLAFCRRIEQHYFEDRGKGRL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTX2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Metaxin-2 GST (N-Term) Protein

  • metaxin 2
  • metaxin-2
  • MGC111067
  • Mitochondrial outer membrane import complex protein 2

Background

The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87741
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-14620
Species: Hu
Applications: IHC, IHC-P
NBP2-94703
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB300-131
Species: Bv, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP1-87466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP1-87346
Species: Hu
Applications: IHC, IHC-P
NB100-1919
Species: Ca, Fe, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-93477
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF2390
Species: Hu
Applications: Simple Western, WB
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP1-59598
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-84509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
210-TA
Species: Hu
Applications: BA
NBP1-84366
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81556
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, Simple Western, WB
NBP2-32488
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010651-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Metaxin-2 Partial Recombinant Protein (H00010651-Q01) (0)

There are no publications for Metaxin-2 Partial Recombinant Protein (H00010651-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Metaxin-2 Partial Recombinant Protein (H00010651-Q01) (0)

There are no reviews for Metaxin-2 Partial Recombinant Protein (H00010651-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Metaxin-2 Partial Recombinant Protein (H00010651-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Metaxin-2 Products

Bioinformatics Tool for Metaxin-2 Partial Recombinant Protein (H00010651-Q01)

Discover related pathways, diseases and genes to Metaxin-2 Partial Recombinant Protein (H00010651-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Metaxin-2 Partial Recombinant Protein (H00010651-Q01)

Discover more about diseases related to Metaxin-2 Partial Recombinant Protein (H00010651-Q01).
 

Pathways for Metaxin-2 Partial Recombinant Protein (H00010651-Q01)

View related products by pathway.

PTMs for Metaxin-2 Partial Recombinant Protein (H00010651-Q01)

Learn more about PTMs related to Metaxin-2 Partial Recombinant Protein (H00010651-Q01).
 

Research Areas for Metaxin-2 Partial Recombinant Protein (H00010651-Q01)

Find related products by research area.

Blogs on Metaxin-2

There are no specific blogs for Metaxin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Metaxin-2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTX2