MERIT40/HSPC142 Antibody

Images

 
Western Blot: MERIT40/HSPC142 Antibody [NBP2-58126] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: MERIT40/HSPC142 Antibody [NBP2-58126] - Staining of human cell line A-431 shows localization to nuclear bodies.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MERIT40/HSPC142 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICL
Specificity
Specificity of human MERIT40/HSPC142 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BABAM1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MERIT40/HSPC142 Recombinant Protein Antigen (NBP2-58126PEP)

Reactivity Notes

Mouse 80%, Rat 80%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MERIT40/HSPC142 Antibody

  • BABAM1
  • BRISC and BRCA1 A complex member 1
  • C10orf62
  • C19orf62
  • chromosome 19 open reading frame 62
  • FLJ20571
  • HSPC142
  • mediator of Rap80 interactions and targeting 40 kDa
  • Mediator of RAP80 interactions and targeting subunit of 40 kDa
  • MERIT40
  • MERIT40BRCA1-A complex subunit MERIT40
  • NBA1
  • NBA1BRISC and BRCA1 A complex member
  • new component of the BRCA1 A complex
  • New component of the BRCA1-A complex
  • new component of the BRCAA1 A complex

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76831
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-404
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NBP1-87156
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32304
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, KO
NBP2-56444
Species: Hu
Applications: WB, IHC, IHC-P
NB100-319
Species: Hu
Applications: WB, IP
NB100-304
Species: Hu, Mu, Rt, Bt, Bv, Ca, Fi, Gt, Pm
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, Flow-IC, KD, KO
NBP1-31883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24694
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-88361
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
NB100-56346
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
H00165918-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NB100-395
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for MERIT40/HSPC142 Antibody (NBP2-58126) (0)

There are no publications for MERIT40/HSPC142 Antibody (NBP2-58126).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MERIT40/HSPC142 Antibody (NBP2-58126) (0)

There are no reviews for MERIT40/HSPC142 Antibody (NBP2-58126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MERIT40/HSPC142 Antibody (NBP2-58126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MERIT40/HSPC142 Products

Bioinformatics Tool for MERIT40/HSPC142 Antibody (NBP2-58126)

Discover related pathways, diseases and genes to MERIT40/HSPC142 Antibody (NBP2-58126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MERIT40/HSPC142 Antibody (NBP2-58126)

Discover more about diseases related to MERIT40/HSPC142 Antibody (NBP2-58126).
 

Pathways for MERIT40/HSPC142 Antibody (NBP2-58126)

View related products by pathway.

Blogs on MERIT40/HSPC142

There are no specific blogs for MERIT40/HSPC142, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MERIT40/HSPC142 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BABAM1