Recombinant Human Menin Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Menin Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 506 - 615 of Human MEN1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DKGLGTGQGAVSGPPRKPPGTVAGTARGPEGGSTAQVPAPAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYTLSFLKRQRKGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MEN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Menin Protein

  • MEAI
  • MEN1
  • Menin
  • multiple endocrine neoplasia I
  • multiple

Background

MEN1 - multiple endocrine neoplasia I

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13955
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
AF1555
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB600-248
Species: Hu
Applications: WB, IP
NBP2-35213
Species: Hu
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-184
Species: Hu, Mu
Applications: WB, IP
AF313
Species: Hu
Applications: WB, Simple Western, IHC, Block
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB120-3216
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-15141
Species: Hu
Applications: WB
H00004221-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Menin Partial Recombinant Protein (H00004221-Q01) (0)

There are no publications for Menin Partial Recombinant Protein (H00004221-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Menin Partial Recombinant Protein (H00004221-Q01) (0)

There are no reviews for Menin Partial Recombinant Protein (H00004221-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Menin Partial Recombinant Protein (H00004221-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Menin Products

Bioinformatics Tool for Menin Partial Recombinant Protein (H00004221-Q01)

Discover related pathways, diseases and genes to Menin Partial Recombinant Protein (H00004221-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Menin Partial Recombinant Protein (H00004221-Q01)

Discover more about diseases related to Menin Partial Recombinant Protein (H00004221-Q01).
 

Pathways for Menin Partial Recombinant Protein (H00004221-Q01)

View related products by pathway.

PTMs for Menin Partial Recombinant Protein (H00004221-Q01)

Learn more about PTMs related to Menin Partial Recombinant Protein (H00004221-Q01).
 

Research Areas for Menin Partial Recombinant Protein (H00004221-Q01)

Find related products by research area.

Blogs on Menin

There are no specific blogs for Menin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Menin Antibody
NB100-215

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Menin Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MEN1
Entrez