Recombinant Human Melusin/ITGB1BP2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Melusin/ITGB1BP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-347 of Human ITGB1BP2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
ITGB1BP2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Melusin/ITGB1BP2 Protein

  • CHORDC3
  • integrin beta 1 binding protein (melusin) 2
  • integrin beta-1-binding protein 2
  • ITGB1BP
  • ITGB1BP2
  • Melusin
  • MGC119214

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38518
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47279
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-33278
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-00555
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56655
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Melusin/ITGB1BP2 Products

Bioinformatics Tool for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

Discover related pathways, diseases and genes to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

Discover more about diseases related to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
 

Pathways for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

View related products by pathway.

PTMs for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

Learn more about PTMs related to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
 

Research Areas for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)

Find related products by research area.

Blogs on Melusin/ITGB1BP2

There are no specific blogs for Melusin/ITGB1BP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Melusin/ITGB1BP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB1BP2
Entrez