Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein Summary
Description |
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-347 of Human ITGB1BP2 full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence: MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Full Length Recombinant Protein |
Gene |
ITGB1BP2 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
64.8 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Melusin/ITGB1BP2 GST (N-Term) Protein
Background
ITGB1BP2 is a gene which codes for a protein that is expressed in skeletal and cardiac muscles that may play a role during the organization and maturation of muscle cells and is comprised of 347 amino acids, weighing approximately 38 kDa. Studies are being conducted on diseases and disorders relating to this gene including muscular dystrophy, cardiomyopathy, hypertension and hypertrophy. ITGB1BP2 has also been shown to have interactions with EDC, SUGT1, HSP90AA1, RARA, and RARG.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: ChHa, Hu
Applications: IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IP, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: AdBlk, CyTOF-ready, Flow, ICC
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: Bind
Species: Hu
Applications: WB, ELISA, PA, AP
Publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)
There are no publications for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)
There are no reviews for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01) (0)
Additional Melusin/ITGB1BP2 Products
Bioinformatics Tool for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)
Discover related pathways, diseases and genes to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)
Discover more about diseases related to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
| | Pathways for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)
View related products by pathway.
|
PTMs for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)
Learn more about PTMs related to Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01).
| | Research Areas for Melusin/ITGB1BP2 Recombinant Protein (H00026548-P01)
Find related products by research area.
|
Blogs on Melusin/ITGB1BP2