Melatonin R1A/MT1/MTNR1A Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Melatonin R1A/MT1/MTNR1A. Peptide sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVV The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MTNR1A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Melatonin R1A/MT1/MTNR1A Antibody - BSA Free
Background
Melatonin Receptor 1A encodes one of two high affinity forms of a receptor for melatonin, the primary hormone secreted by the pineal gland. This receptor is a G-protein coupled, 7-transmembrane receptor that is responsible for melatonin effects on mammalian circadian rhythm and reproductive alterations affected by day length. The receptor is an integral membrane protein that is readily detectable and localized to two specific regions of the brain. The hypothalamic suprachiasmatic nucleus appears to be involved in circadian rhythm while the hypophysial pars tuberalis may be responsible for the reproductive effects of melatonin. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
Species: Hu
Applications: WB
Publications for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159) (0)
There are no publications for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159) (0)
There are no reviews for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159). (Showing 1 - 1 of 1 FAQ).
-
I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
- At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.
Secondary Antibodies
| |
Isotype Controls
|
Additional Melatonin R1A/MT1/MTNR1A Products
Research Areas for Melatonin R1A/MT1/MTNR1A Antibody (NBP2-84159)
Find related products by research area.
|
Blogs on Melatonin R1A/MT1/MTNR1A