Melanophilin Antibody

Images

 
Immunohistochemistry-Paraffin: Melanophilin Antibody [NBP1-84765] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Melanophilin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELTSNVSDQETSSEEEEAKDEKAEPNRDKSVGPLPQADPEVSDIESRIAALRAAGLTVKPSGKPRRKSNLPIFL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLPH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Melanophilin Protein (NBP1-84765PEP)
Publications
Read Publications using
NBP1-84765 in the following applications:

  • IHC
    2 publications

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25389781).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Melanophilin Antibody

  • exophilin-3
  • l(1)-3Rk
  • l1Rk3
  • ln
  • melanophilin
  • MGC2771
  • MGC59733
  • SLAC2A
  • Slac-2a
  • SLAC2-A
  • Slp homolog lacking C2 domains a
  • Synaptotagmin-like protein 2a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00005873-M02
Species: Hu
Applications: WB, ELISA, IHC-P, RNAi
NBP1-92156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-1278
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-84266
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-86053
Species: Hu
Applications: IHC, IHC-P
NB120-3335
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IP
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00004218-M02
Species: Hu
Applications: WB, ELISA
NBP1-80991
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00005874-B01P
Species: Hu, Rb
Applications: WB, ICC/IF
NBP1-84764
Species: Hu
Applications: IHC, IHC-P
NBP1-84958
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84765
Species: Hu
Applications: IHC, IHC-P

Publications for Melanophilin Antibody (NBP1-84765)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Melanophilin Antibody (NBP1-84765) (0)

There are no reviews for Melanophilin Antibody (NBP1-84765). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Melanophilin Antibody (NBP1-84765) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Melanophilin Products

Bioinformatics Tool for Melanophilin Antibody (NBP1-84765)

Discover related pathways, diseases and genes to Melanophilin Antibody (NBP1-84765). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanophilin Antibody (NBP1-84765)

Discover more about diseases related to Melanophilin Antibody (NBP1-84765).
 

Pathways for Melanophilin Antibody (NBP1-84765)

View related products by pathway.

PTMs for Melanophilin Antibody (NBP1-84765)

Learn more about PTMs related to Melanophilin Antibody (NBP1-84765).

Blogs on Melanophilin

There are no specific blogs for Melanophilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melanophilin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLPH