Recombinant Human Melanocortin-2 R/MC2R Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Melanocortin-2 R/MC2R Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 297 of Human MC2R full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKHIINSYENINNTARNNSDCPRVVLPEEIFFTISIVGVLENLIVLLAVFKNKNLQAPMYFFICSLAISDMLGSLYKILENILIILRNMGYLKPRGSFETTADDIIDSLFVLSLLGSIFSLSVIAADRYITIFHALRYHSIVTMRRTVVVLTVIWTFCTGTGITMVIFSHHVPTVITFTSLFPLMLVFILCLYVHMFLLARSHTRKISTLPRANMKGAITLTILLGVFIFCWAPFVLHVLLMTFCPSNPYCACYMSLFQVNGMLIMCNAVIDPFIYAFRSPELRDAFKKMIFCSRYW

Protein/Peptide Type
Recombinant Protein
Gene
MC2R

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Melanocortin-2 R/MC2R Protein

  • ACTH receptor
  • ACTHR
  • ACTH-R
  • ACTHRcorticotropin receptor
  • adrenocorticotropic hormone receptor
  • Adrenocorticotropin receptor
  • MC2 receptor
  • MC2R
  • MC2-R
  • melanocortin 2 receptor (adrenocorticotropic hormone)
  • Melanocortin receptor 2
  • Melanocortin-2 R
  • Melanocortin2R
  • Melanocortin-2R
  • MGC125798

Background

MC2R encodes one member of the five-member G-protein associated melanocortin receptor family. Melanocortins (melanocyte-stimulating hormones and adrenocorticotropic hormone) are peptides derived from pro-opiomelanocortin (POMC). MC2R is selectively activated by adrenocorticotropic hormone, whereas the other four melanocortin receptors recognize a variety of melanocortin ligands. Mutations in MC2R can result in familial glucocorticoid deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
PP-H7431-00
Species: Hu
Applications: WB
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB8205
Species: Hu
Applications: Flow, CyTOF-ready
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3737
Species: Mu
Applications: Flow, CyTOF-ready
NBP2-41103
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004158-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01) (0)

There are no publications for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01) (0)

There are no reviews for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Melanocortin-2 R/MC2R Products

Bioinformatics Tool for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01)

Discover related pathways, diseases and genes to Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01)

Discover more about diseases related to Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01).
 

Pathways for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01)

View related products by pathway.

PTMs for Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01)

Learn more about PTMs related to Melanocortin-2 R/MC2R Recombinant Protein (H00004158-P01).

Blogs on Melanocortin-2 R/MC2R

There are no specific blogs for Melanocortin-2 R/MC2R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

POMC Antibody
NB100-1533

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Melanocortin-2 R/MC2R Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MC2R
Entrez