Melanocortin-1 R/MC1R Antibody - BSA Free Summary
Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Melanocortin-1 R/MC1R. Peptide sequence: CPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAFHSQELRRTLKEVLTCS The peptide sequence for this immunogen was taken from within the described region. |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MC1R |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for Melanocortin-1 R/MC1R Antibody - BSA Free
Background
MC1R, a Melanocortin Receptor, mediates the effects of melanocyte-stimulating hormone (MSH) and adrenocorticotropic hormone (ACTH). MSH and its receptor, MC1R, are key regulators of melanogenesis. They control the relative proportions of red pheomelanin and black photoprotective eumelanin in the skin by increasing the production of eumelanin. Non-functional, truncated forms of the receptor lead to lighter coat color in animals. In contrast, constitutively active receptors lead to darker color. Pheomelanin generates free radicals in response to UV radiation, and elevated levels of pheomelanin have been associated with higher risk of UV-induced skin damage. Therefore, MC1R is a major determinant of sun sensitivity and genetic risk for melanoma and other skin cancers. Expression of melanocortin 1 receptor has been reported primarily in adrenal, skin, and testis. ESTs have been isolated from breast, placenta, and testis libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Publications for Melanocortin-1 R/MC1R Antibody (NBP2-84156) (0)
There are no publications for Melanocortin-1 R/MC1R Antibody (NBP2-84156).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Melanocortin-1 R/MC1R Antibody (NBP2-84156) (0)
There are no reviews for Melanocortin-1 R/MC1R Antibody (NBP2-84156).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Melanocortin-1 R/MC1R Antibody (NBP2-84156) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Melanocortin-1 R/MC1R Products
Research Areas for Melanocortin-1 R/MC1R Antibody (NBP2-84156)
Find related products by research area.
|
Blogs on Melanocortin-1 R/MC1R