MEKK4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MEKK4 Antibody [NBP1-87734] - Staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: MEKK4 Antibody [NBP1-87734] - Staining of human pancreas shows strong nuclear and moderate cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MEKK4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILTFKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMELLEYIEALYPSLQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP3K4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MEKK4 Protein (NBP1-87734PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MEKK4 Antibody

  • EC 2.7.11.25
  • FLJ42439
  • MAPKKK4yeast, homolog of
  • MEKK 4
  • mitogen-activated protein kinase kinase kinase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
25910002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP

Publications for MEKK4 Antibody (NBP1-87734) (0)

There are no publications for MEKK4 Antibody (NBP1-87734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK4 Antibody (NBP1-87734) (0)

There are no reviews for MEKK4 Antibody (NBP1-87734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MEKK4 Antibody (NBP1-87734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEKK4 Products

Bioinformatics Tool for MEKK4 Antibody (NBP1-87734)

Discover related pathways, diseases and genes to MEKK4 Antibody (NBP1-87734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK4 Antibody (NBP1-87734)

Discover more about diseases related to MEKK4 Antibody (NBP1-87734).
 

Pathways for MEKK4 Antibody (NBP1-87734)

View related products by pathway.

PTMs for MEKK4 Antibody (NBP1-87734)

Learn more about PTMs related to MEKK4 Antibody (NBP1-87734).
 

Research Areas for MEKK4 Antibody (NBP1-87734)

Find related products by research area.

Blogs on MEKK4

There are no specific blogs for MEKK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K4