MEKK4 Antibody (4C3)

Images

 
Western Blot: MEKK4 Antibody (4C3) [H00004216-M05] - Analysis of MAP3K4 expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
4C3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MEKK4 Antibody (4C3) Summary

Immunogen
MAP3K4 (NP_005913 1201 a.a. - 1300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Specificity
MAP3K4 - mitogen-activated protein kinase kinase kinase 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEKK4 Antibody (4C3)

  • EC 2.7.11.25
  • FLJ42439
  • MAPKKK4yeast, homolog of
  • MEKK 4
  • mitogen-activated protein kinase kinase kinase 4

Background

The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
25910002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP

Publications for MEKK4 Antibody (H00004216-M05) (0)

There are no publications for MEKK4 Antibody (H00004216-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK4 Antibody (H00004216-M05) (0)

There are no reviews for MEKK4 Antibody (H00004216-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK4 Antibody (H00004216-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEKK4 Products

Bioinformatics Tool for MEKK4 Antibody (H00004216-M05)

Discover related pathways, diseases and genes to MEKK4 Antibody (H00004216-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK4 Antibody (H00004216-M05)

Discover more about diseases related to MEKK4 Antibody (H00004216-M05).
 

Pathways for MEKK4 Antibody (H00004216-M05)

View related products by pathway.

PTMs for MEKK4 Antibody (H00004216-M05)

Learn more about PTMs related to MEKK4 Antibody (H00004216-M05).
 

Research Areas for MEKK4 Antibody (H00004216-M05)

Find related products by research area.

Blogs on MEKK4

There are no specific blogs for MEKK4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK4 Antibody (4C3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K4
Entrez
OMIM
Uniprot