Home » MEKK1 » MEKK1 Antibodies » MEKK1 Antibody (2F6) - Azide and BSA Free

MEKK1 Antibody (2F6) - Azide and BSA Free

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, IHC, IHC-P, CyTOF-ready, ICC/IF
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free
Concentration
1.0 mg/ml

Order Details

View Available Conjugates
Catalog# & Conjugate Size Price
Alexa Fluor 350
NBP2-47810AF350
Alexa Fluor 405
NBP2-47810AF405
Alexa Fluor 488
NBP2-47810AF488
Alexa Fluor 532
NBP2-47810AF532
Alexa Fluor 594
NBP2-47810AF594
Alexa Fluor 647
NBP2-47810AF647
Alexa Fluor 700
NBP2-47810AF700
Alexa Fluor 750
NBP2-47810AF750
Allophycocyanin
NBP2-47810APC
Biotin
NBP2-47810B
DyLight 350
NBP2-47810UV
DyLight 405
NBP2-47810V
DyLight 488
NBP2-47810G
DyLight 550
NBP2-47810R
DyLight 594
NBP2-47810DL594
DyLight 650
NBP2-47810C
DyLight 680
NBP2-47810FR
DyLight 755
NBP2-47810IR
FITC
NBP2-47810F
HRP
NBP2-47810H
Janelia Fluor 549
NBP2-47810JF549
Janelia Fluor 646
NBP2-47810JF646
PE
NBP2-47810PE
PerCP
NBP2-47810PCP
Unconjugated
NBP2-44405-0.1mg
View Available Formulations
Catalog# & Formulation Size Price
Standard Formulation
NBP2-44405-0.1mg
IHC-Prediluted
NBP2-48208
100% Guarantee on every product

MEKK1 Antibody (2F6) - Azide and BSA Free Summary

Immunogen
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Localization
Cytoplasmic
Specificity
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K1
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot : 0.5 - 1.0 ug/ml
  • Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml
  • CyTOF-ready
  • Immunofluorescence : 1 - 2 ug/ml
Application Notes
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.
Control
MEKK1 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
10 mM PBS
Preservative
No Preservative
Concentration
1.0 mg/ml
Purity
Protein A or G purified

Alternate Names for MEKK1 Antibody (2F6) - Azide and BSA Free

  • Map3k1
  • MAPK/ERK kinase kinase 1
  • MAPKKK1MAP/ERK kinase kinase 1
  • MEK kinase 1
  • MEKK1EC 2.7.11.25
  • MEKKMEKK 1
  • mitogen-activated protein kinase kinase kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERK2 Antibody
(191801) [Unconjugate
MAB1230
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, U937 human histiocytic lymphoma cell line,PC‑12 rat adrenal pheochromocytoma cell line, and NIH‑3T3 mouse embryonic fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for ERK2 at approximately 44 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ERK2 was detected in immersion fixed 3T3‑L1 mouse embryonic fibroblast adipose-like cell line using Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and MCF‑7 human breast cancer cell line, loaded at 0.5 mg/mL. A specific band was detected for ERK2 at approximately 43 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human/Mouse/Rat ERK2 Monoclonal Antibody (Catalog # MAB1230). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MKK4/MEK4 Antibody
(OTI8A8)
NBP1-47839
Western Blot: MKK4/MEK4 Antibody (OTI8A8) [NBP1-47839] - Analysis of extracts (35ug) from 9 different cell lines by using anti-MEK4 monoclonal antibody.
Immunocytochemistry/Immunofluorescence: MKK4/MEK4 Antibody (OTI8A8) [NBP1-47839] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY MEK4.
Immunohistochemistry-Paraffin: MKK4/MEK4 Antibody (OTI8A8) [NBP1-47839] - Staining of paraffin-embedded Human thyroid tissue using anti-MEK4 mouse monoclonal antibody.
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
ERK1 Antibody (1E5)
NBP2-22203
Western Blot: ERK1 Antibody (1E5) [NBP2-22203] - Western blot analysis of whole cell lysates from (1) MCF7 (2) NIH3T3 cell lines using ERK1 antibody (clone 1E5) at 1:1000 dilution. The signal was developed using HRP labeled goat-anti Mouse secondary antibody with ECL based detection.
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Immunohistochemical analysis of paraffin-embedded breast cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(35 Reviews)
(649 Publications)
Species: Hu
MEK1 Antibody
(SZ22-01)
NBP2-67358
Western Blot: MEK1 Antibody (SZ22-01) [NBP2-67358] - Whole cell lysates (30 ug per lane) from three different hematological cancer cell lines. Antibody at 1:1000. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: MEK1 Antibody (SZ22-01) [NBP2-67358] - Staining MEK1 in NIH/3T3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100/PBS.
Immunohistochemistry-Paraffin: MEK1 Antibody (SZ22-01) [NBP2-67358] - Analysis of paraffin-embedded mouse uterus tissue using anti-MEK1 antibody. Counter stained with hematoxylin.
(1 Review)
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Raf-1 Antibody
(563002)
MAB4540
Western blot shows lysates of MCF‑7 human breast cancer cell line, HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, L‑929 mouse fibroblast cell line, and NRK rat normal kidney cell line. PVDF Membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Raf‑1 at approximately 74 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
Raf‑1 was detected in immersion fixed paraffin-embedded sections of human liver array using Mouse Anti-Human/Mouse/Rat Raf‑1 Monoclonal Antibody (Catalog # MAB4540) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, IHC
SGSM3 Antibody
NBP2-13304
Western Blot: SGSM3 Antibody [NBP2-13304] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/Immunofluorescence: SGSM3 Antibody [NBP2-13304] - Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: SGSM3 Antibody [NBP2-13304] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
p38 alpha [p
Thr180, p Tyr182] Ant
NB500-138
Western Blot: p38 [p Thr180, p Tyr182] Antibody [NB500-138] - Hela cell lysates that had been treated with UV or untreated (Control) showing specific immunolabeling of the -39 kDa p38 MAPK protein phosphorylated at Thr180/Tyr182.
Immunohistochemistry-Paraffin: p38 [p Thr180, p Tyr182] Antibody [NB500-138] - Immunostaining of human breast cancer tissue showing p38 when phosphorylated at Thr180/Tyr182 in red.
Western Blot: p38 [p Thr180, p Tyr182] Antibody [NB500-138] - Western blot of HeLa cell lysates that had been treated with UV or untreated (Control) showing specific immunolabeling of the ~39k p38 MAPK protein phosphorylated at Thr180/Tyr182.
(12 Publications)
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NFkB p105/p50
Antibody (2J10D7)
NB100-56583
Western Blot: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - Analysis of p50 in HeLa lysate in the A) absence and B) presence of immunizing peptide using p50 antibody at 5 ug/ml.
Immunohistochemistry-Paraffin: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - IHC-P of rabbit aorta using NB100-56583. Secondary antibody: anti-mouse histofine ( Nisherei Bioscience Inc. ref: 414131F). Development: DAB (Dako ref: K346811-2) and counterstained with Hematoxylin. Submitted via verified customer review
Flow Cytometry: NFkB p105/p50 Antibody (2J10D7) [NB100-56583] - An intracellular stain was performed on U937 cells with NFkB p105/p50 [2J10D7] Antibody NB100-56583C (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 650.
(1 Review)
(4 Publications)
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
JNK2 Antibody
(252320) [Unconjugate
MAB1846
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and C2C12 mouse myoblast cell line. PVDF membrane was probed with 0.2 µg/mL Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). For additional reference, recombinant human JNK1, JNK2, and JNK3 (1 ng/lane) were included. Specific bands for JNK2 were detected at approximately 46 and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HEK293T human embryonic kidney parental cell line and JNK2 knockout HEK293T cell line (KO). PVDF membrane was probed with 0.2 µg/mL of Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for JNK2 at approximately 45 and 54 kDa (as indicated) in the parental HEK293T cell line, but is not detectable in knockout HEK293T cell line. GAPDH (Catalog # MAB5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
JNK2 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse/Rat JNK2 Monoclonal Antibody (Catalog # MAB1846) at 25 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
Crk Antibody
(3G11E8)
NBP2-37568
Western Blot: Crk Antibody (3G11E8) [NBP2-37568] - Western blot analysis using CRK mAb against HEK293 (1) and CRK(AA: 1-204)-hIgGFc transfected HEK293 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: Crk Antibody (3G11E8) [NBP2-37568] - Immunofluorescence analysis of 3T3-L1 cells using CRK mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Crk Antibody (3G11E8) [NBP2-37568] - Immunohistochemical analysis of paraffin-embedded lung cancer tissues using CRK mouse mAb with DAB staining.
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
POLDIP2 Antibody
NBP1-68874
Western Blot: POLDIP2 Antibody [NBP1-68874] - Staining of K562 (A), MCF7 (B) and Mouse Liver (C) lysates (35ug protein in RIPA buffer). Primary incubation was overnight at 4C. Detected by chemiluminescence.
Western Blot: POLDIP2 Antibody [NBP1-68874] - (1ug/ml) Analysis of MCF7 lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Western Blot: GRAP2 Antibody (1G2) [NBP2-00764] Analysis of extracts (35ug) from 9 different cell lines by using anti-GRAP2 monoclonal antibody.
Immunohistochemistry-Paraffin: GRAP2 Antibody (1G2) [NBP2-00764] - Staining of paraffin-embedded Human endometrium tissue using anti-GRAP2 mouse monoclonal antibody.
Flow Cytometry: GRAP2 Antibody (1G2) [NBP2-00764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-GRAP2 antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
MEKK1 Antibody
(2F6) - Azide and BSA ...
NBP2-47810
MEKK1 Antibody (2F6) - Azide and BSA Free
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, ICC/IF

Publications for MEKK1 Antibody (NBP2-47810) (0)

There are no publications for MEKK1 Antibody (NBP2-47810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK1 Antibody (NBP2-47810) (0)

There are no reviews for MEKK1 Antibody (NBP2-47810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK1 Antibody (NBP2-47810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

MEKK1 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP2-47810AF350
Alexa Fluor 405 NBP2-47810AF405
Alexa Fluor 488 NBP2-47810AF488
Alexa Fluor 532 NBP2-47810AF532
Alexa Fluor 594 NBP2-47810AF594
Alexa Fluor 647 NBP2-47810AF647
Alexa Fluor 700 NBP2-47810AF700
Alexa Fluor 750 NBP2-47810AF750
Allophycocyanin NBP2-47810APC
Biotin NBP2-47810B
DyLight 350 NBP2-47810UV
DyLight 405 NBP2-47810V
DyLight 488 NBP2-47810G
DyLight 550 NBP2-47810R
DyLight 594 NBP2-47810DL594
DyLight 650 NBP2-47810C
DyLight 680 NBP2-47810FR
DyLight 755 NBP2-47810IR
FITC NBP2-47810F
HRP NBP2-47810H
Janelia Fluor 549 NBP2-47810JF549
Janelia Fluor 646 NBP2-47810JF646
PE NBP2-47810PE
PerCP NBP2-47810PCP
Learn about Custom Antibody Labeling

Additional MEKK1 Products

Array NBP2-47810

Bioinformatics Tool for MEKK1 Antibody (NBP2-47810)

Discover related pathways, diseases and genes to MEKK1 Antibody (NBP2-47810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK1 Antibody (NBP2-47810)

Discover more about diseases related to MEKK1 Antibody (NBP2-47810).
 

Pathways for MEKK1 Antibody (NBP2-47810)

View related products by pathway.

PTMs for MEKK1 Antibody (NBP2-47810)

Learn more about PTMs related to MEKK1 Antibody (NBP2-47810).
 

Research Areas for MEKK1 Antibody (NBP2-47810)

Find related products by research area.

Blogs on MEKK1

There are no specific blogs for MEKK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK1 Antibody (2F6) - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP3K1