MEKK1 Antibody (2F6) - Azide and BSA Free

Images

 
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Uterine Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Cervical Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).
Immunohistochemistry-Paraffin: MEKK1 Antibody (2F6) - Azide and BSA Free [NBP2-47810] - Human Thyroid Carcinoma stained with MAP3K1 Monoclonal Antibody (2F6).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, IHC, IHC-P, CyTOF-ready, ICC/IF
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Format
Azide and BSA Free
Concentration
1.0 mg/ml

Order Details

MEKK1 Antibody (2F6) - Azide and BSA Free Summary

Immunogen
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Localization
Cytoplasmic
Specificity
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K1
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot : 0.5 - 1.0 ug/ml
  • Flow Cytometry 0.5 - 1 ug/million cells in 0.1 ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin : 0.5 - 1.0 ug/ml
  • CyTOF-ready
  • Immunofluorescence : 1 - 2 ug/ml
Application Notes
Immunohistochemistry (Formalin-fixed): 1-2ug/ml for 30 minutes at RT. Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris Buffer with 1mM EDTA, pH 9.0, for 45 min at 95C followed by cooling at RT for 20 minutes.
Optimal dilution for a specific application should be determined.
Control
MEKK1 Knockout HeLa Cell Lysate

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
10 mM PBS
Preservative
No Preservative
Concentration
1.0 mg/ml
Purity
Protein A or G purified

Alternate Names for MEKK1 Antibody (2F6) - Azide and BSA Free

  • Map3k1
  • MAPK/ERK kinase kinase 1
  • MAPKKK1MAP/ERK kinase kinase 1
  • MEK kinase 1
  • MEKK1EC 2.7.11.25
  • MEKKMEKK 1
  • mitogen-activated protein kinase kinase kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-47839
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-47810
Species: Hu
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, ICC/IF

Publications for MEKK1 Antibody (NBP2-47810) (0)

There are no publications for MEKK1 Antibody (NBP2-47810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK1 Antibody (NBP2-47810) (0)

There are no reviews for MEKK1 Antibody (NBP2-47810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK1 Antibody (NBP2-47810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Alexa Fluor 350 NBP2-47810AF350
Alexa Fluor 405 NBP2-47810AF405
Alexa Fluor 488 NBP2-47810AF488
Alexa Fluor 532 NBP2-47810AF532
Alexa Fluor 594 NBP2-47810AF594
Alexa Fluor 647 NBP2-47810AF647
Alexa Fluor 700 NBP2-47810AF700
Alexa Fluor 750 NBP2-47810AF750
Allophycocyanin NBP2-47810APC
Biotin NBP2-47810B
DyLight 350 NBP2-47810UV
DyLight 405 NBP2-47810V
DyLight 488 NBP2-47810G
DyLight 550 NBP2-47810R
DyLight 594 NBP2-47810DL594
DyLight 650 NBP2-47810C
DyLight 680 NBP2-47810FR
DyLight 755 NBP2-47810IR
FITC NBP2-47810F
HRP NBP2-47810H
Janelia Fluor 549 NBP2-47810JF549
Janelia Fluor 646 NBP2-47810JF646
PE NBP2-47810PE
PerCP NBP2-47810PCP

Additional MEKK1 Products

Array NBP2-47810

Bioinformatics Tool for MEKK1 Antibody (NBP2-47810)

Discover related pathways, diseases and genes to MEKK1 Antibody (NBP2-47810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK1 Antibody (NBP2-47810)

Discover more about diseases related to MEKK1 Antibody (NBP2-47810).
 

Pathways for MEKK1 Antibody (NBP2-47810)

View related products by pathway.

PTMs for MEKK1 Antibody (NBP2-47810)

Learn more about PTMs related to MEKK1 Antibody (NBP2-47810).
 

Research Areas for MEKK1 Antibody (NBP2-47810)

Find related products by research area.

Blogs on MEKK1

There are no specific blogs for MEKK1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK1 Antibody (2F6) - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K1