MEKK1 Antibody (2F6) [DyLight 755]

Images

 
There are currently no images for MEKK1 Antibody (NBP2-47810IR).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Flow, IHC, IHC-P, ICC/IF
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 755

MEKK1 Antibody (2F6) [DyLight 755] Summary

Immunogen
Partial recombinant MAP3K1 (aa1211-1310) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
Localization
Cytoplasmic
Specificity
Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli, including growth factors. The MEK kinases (also designated MAP kinase kinase kinases, MKKKs, MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs), including ERK, JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1, Raf-B, Mos, MEK kinase-1, MEK kinase-2, MEK kinase-3, MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4, and also activates the central protein kinases of the NF B pathway, CHUK and IKBKB. Additionally, MEK kinase-1 uses an E3 ligase through its PHD domain, a RING-finger-like structure, to target proteins for degradation through ubiquitination.
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K1
Purity
Protein A or G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Flow Cytometry
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunofluorescence
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A or G purified

Alternate Names for MEKK1 Antibody (2F6) [DyLight 755]

  • MAPK/ERK kinase kinase 1
  • MAPKKK1MAP/ERK kinase kinase 1
  • MEK kinase 1
  • MEKK1EC 2.7.11.25
  • MEKKMEKK 1
  • mitogen-activated protein kinase kinase kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4540
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC, KO
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for MEKK1 Antibody (NBP2-47810IR) (0)

There are no publications for MEKK1 Antibody (NBP2-47810IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK1 Antibody (NBP2-47810IR) (0)

There are no reviews for MEKK1 Antibody (NBP2-47810IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK1 Antibody (NBP2-47810IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MEKK1 Antibody (NBP2-47810IR)

Discover related pathways, diseases and genes to MEKK1 Antibody (NBP2-47810IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK1 Antibody (NBP2-47810IR)

Discover more about diseases related to MEKK1 Antibody (NBP2-47810IR).
 

Pathways for MEKK1 Antibody (NBP2-47810IR)

View related products by pathway.

PTMs for MEKK1 Antibody (NBP2-47810IR)

Learn more about PTMs related to MEKK1 Antibody (NBP2-47810IR).
 

Research Areas for MEKK1 Antibody (NBP2-47810IR)

Find related products by research area.

Blogs on MEKK1

There are no specific blogs for MEKK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MEKK1 Antibody (2F6) [DyLight 755] and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP3K1