MEK2 Antibody - Azide and BSA Free

Western Blot: MEK2 Antibody [NBP3-02952] - Western blot analysis of extracts of HeLa cells, using MEK2 antibody (NBP3-02952) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Western Blot: MEK2 Antibody [NBP3-02952] - Western blot analysis of extracts of various cell lines, using MEK2 antibody (NBP3-02952) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: MEK2 Antibody - Azide and BSA Free [NBP3-02952] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] MEK2 Rabbit pAb (A14770) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: MEK2 Antibody - Azide and BSA Free [NBP3-02952] - Immunofluorescence analysis of U2OS cells using [KO Validated] MEK2 Rabbit pAb (A14770) at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MEK2 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit MEK2 Antibody - Azide and BSA Free (NBP3-02952) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MEK2 (NP_109587.1). MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMAR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP2K2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:100-1:200
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MEK2 Antibody - Azide and BSA Free

• ERK activator kinase 2
• MAP2K2
• MAPKK 2
• MEK 2
• MEK2
• MEK2EC 2.7.12.2
• mitogen-activated protein kinase kinase 2
• MKK2
• MKK2FLJ26075
• p45
• PRKMK2MAPKK2

Background

MEK1 and MEK2 (MAPK kinase 1/2, or ERK kinase 1/2) are mitogen-activated protein kinases that stimulate MAP kinase activity, playing a role in both cell growth and differentiation (1,2). MEK itself is activated via phosphorylation at serines 217/218 and 221/222 by upstream activator kinases, including c-raf, mos and MEK kinase (3,4). MEK1 and MEK2 are activated by a wide variety of growth factors and cytokines, and also by membrane depolarization and calcium influx (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MAP2K2