MEK1 Antibody - BSA Free

Western Blot: MEK1 Antibody [NBP1-87790] - Analysis in human cell line U-87 MG.

Immunocytochemistry/Immunofluorescence: MEK1 Antibody [NBP1-87790] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane & cytosol.

MEK1-Antibody-Immunohistochemistry-NBP1-87790-img0008.jpg

Immunohistochemistry-Paraffin: MEK1 Antibody [NBP1-87790] - Staining of human hippocampus shows moderate cytoplasmic positivity in neuronal cells.

Correlation between MEK1 expression and survival after platinum treatment in EOC patients. Expression measured by qRT-PCR: relapse-free survival of 34 patients with low and high MEK1 expressing tumors (A). Expression tested with IHC: overall survival of 59 independent patients with low and high MEK1 expression (B). Representative images of immunohistochemistry, low and high expression of MEK1 at low and high magnifications (C).

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MEK1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP2K1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25408231). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MEK1 Protein (NBP1-87790PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25408231).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MEK1 Antibody - BSA Free

• dual specificity mitogen-activated protein kinase kinase 1
• ERK activator kinase 1
• MAP kinase kinase 1
• MAP2K1
• MAPK/ERK kinase 1
• MAPKK1
• MEK1
• MEK1MAPKK 1
• mitogen-activated protein kinase kinase 1
• MKK1
• MKK1MEK 1
• PRKMK1EC 2.7.12.2
• protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1)

Background

MEK 1 (MAP Kinase Kinase, also known as MKK) is an integral component of the MAP kinase cascade that regulates cell growth and differentiation (Ahn, 1993; Chong et al., 2003). This pathway also plays a key role in synaptic plasticity in brain (Adams and Sweatt, 2002). Activated MEK 1 acts as a dual specificity kinase phosphorylating both a threonine and a tyrosine residue on MAP kinase (Kyriakis et al., 1991; Seger et al., 1991; Crews et al., 1992) Conversely there also appears to be a feedback phosphorylation of MEK 1 by MAP kinase. The sites on MEK 1 that are phosphorylated by MAP kinase are Thr292 and Thr386 (Mansour et al., 1994).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MEK1 Antibody (NBP1-87790)(1)

Publication using NBP1-87790

• Penzvalto Z, Lanczky A, Lenart J et al. MEK1 is associated with carboplatin resistance and is a prognostic biomarker in epithelial ovarian cancer. BMC Cancer 2014-11-18 [PMID: 25408231] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MAP2K1