MED6 Antibody

Images

 
Chromatin Immunoprecipitation: MED6 Antibody [NBP3-10314] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MED6 (NP_005457). Peptide sequence LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV
Clonality
Polyclonal
Host
Rabbit
Gene
MED6
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Chromatin Immunoprecipitation
  • Western Blot 1.0 ug/ml
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for MED6 Antibody

  • Activator-recruited cofactor 33 kDa component
  • ARC33
  • mediator complex subunit 6hMed6
  • mediator of RNA polymerase II transcription subunit 6
  • mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 6 homolog
  • NY-REN-28
  • Renal carcinoma antigen NY-REN-28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5520
Species: Hu, Mu
Applications: WB
H00009412-M08
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-83187
Species: Hu
Applications: ChIP, WB
NBP3-13045
Species: Hu
Applications: ICC/IF, WB
NBL1-11392
Species: Hu
Applications: WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC, IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
NB100-61060
Species: Hu, Mu, V-Vi
Applications: ChIP, IP, WB
NBP1-89014
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00009440-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
NBP1-85104
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA

Publications for MED6 Antibody (NBP3-10314) (0)

There are no publications for MED6 Antibody (NBP3-10314).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED6 Antibody (NBP3-10314) (0)

There are no reviews for MED6 Antibody (NBP3-10314). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for MED6 Antibody (NBP3-10314) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED6 Products

Bioinformatics Tool for MED6 Antibody (NBP3-10314)

Discover related pathways, diseases and genes to MED6 Antibody (NBP3-10314). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED6 Antibody (NBP3-10314)

Discover more about diseases related to MED6 Antibody (NBP3-10314).
 

Pathways for MED6 Antibody (NBP3-10314)

View related products by pathway.

PTMs for MED6 Antibody (NBP3-10314)

Learn more about PTMs related to MED6 Antibody (NBP3-10314).

Blogs on MED6

There are no specific blogs for MED6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED6