MED6 Antibody - BSA Free

Chromatin Immunoprecipitation: MED6 Antibody [NBP3-10314] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MED6 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED6 (NP_005457). Peptide sequence LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation (ChIP)
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MED6 Antibody - BSA Free

• Activator-recruited cofactor 33 kDa component
• ARC33
• mediator complex subunit 6hMed6
• mediator of RNA polymerase II transcription subunit 6
• mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
• mediator of RNA polymerase II transcription, subunit 6 homolog
• NY-REN-28
• Renal carcinoma antigen NY-REN-28

Background

MED6 also known as Mediator of RNA polymerase II transcription subunit 6, is a 246 amino acid protein that is 28 kDa; as a component of the Mediator complex, a co-activator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes, functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery, by direct interactions with regulatory proteins the mediator is recruited to promoters and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Disease research is currently being performed with relation to MED6 and spondylolysis, renal carcinoma, carcinoma, renal cell carcinoma, cholesterol, and neuronitis. This protein has also been shown to have interactions with over 70 proteins including SMAD2, SMAD1, CDK8, MED15, and MED25 in developmental biology, transcriptional regulation of white adipocyte differentiation, generic transcription pathway, gene expression, and transcription ligand-dependent transcription of retinoid-target genes pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED6