MED6 Antibody

Chromatin Immunoprecipitation: MED6 Antibody [NBP3-10314] - Quiescent human colon carcinoma HCT116 cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.

• Reactivity: Hu
• Applications: WB, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MED6 Antibody Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED6 (NP_005457). Peptide sequence LLLDLRQKFPPKFVQLKPGEKPVPVDQTKKEAEPIPETVKPEEKETTKNV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 28 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS buffer, 2% sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for MED6 Antibody

• Activator-recruited cofactor 33 kDa component
• ARC33
• mediator complex subunit 6hMed6
• mediator of RNA polymerase II transcription subunit 6
• mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
• mediator of RNA polymerase II transcription, subunit 6 homolog
• NY-REN-28
• Renal carcinoma antigen NY-REN-28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED6