MED27 Antibody - BSA Free

Western Blot: MED27 Antibody [NBP3-10307] - Western blot analysis using NBP3-10307 on Human Brain as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MED27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MED27 Antibody - BSA Free (NBP3-10307) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED27 (NP_004260). Peptide sequence LSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGKLD
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MED27
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 35 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MED27 Antibody - BSA Free

• cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa
• CRSP34CRSP complex subunit 8
• CRSP8CRAP34
• mediator complex subunit 27Transcriptional coactivator CRSP34
• mediator of RNA polymerase II transcription subunit 27
• MGC11274
• P37 TRAP/SMCC/PC2 subunit
• subunit 8 (34kD)
• TRAP37

Background

The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MED27