MED14 Recombinant Protein Antigen

Images

 
There are currently no images for MED14 Recombinant Protein Antigen (NBP2-56318PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED14 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED14.

Source: E. coli

Amino Acid Sequence: PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56318.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED14 Recombinant Protein Antigen

  • Activator-recruited cofactor 150 kDa component
  • ARC150
  • Cofactor required for Sp1 transcriptional activation subunit 2
  • cofactor required for Sp1 transcriptional activation, subunit 2 (150kD)
  • CRSP150
  • CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa
  • CSRP
  • CXorf4MGC104513
  • EXLM1CRSP complex subunit 2
  • human homolog of yeast RGR1
  • mediator complex subunit 14DRIP150
  • mediator of RNA polymerase II transcription subunit 14
  • RGR1RGR1 homolog
  • Thyroid hormone receptor-associated protein complex 170 kDa component
  • thyroid hormone receptor-associated protein complex component TRAP170
  • Transcriptional coactivator CRSP150
  • transcriptional co-activator CRSP150
  • Trap170
  • TRAP170hRGR1
  • vitamin D receptor-interacting protein complex component DRIP150
  • Vitamin D3 receptor-interacting protein complex 150 kDa component

Background

The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NB100-74599
Species: Hu, Mu
Applications: IP, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP3-13814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
H00009440-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
NBP1-84377
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38118
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-87029
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB200-338
Species: Hu, Mu
Applications: IP, WB (-)
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, PEP-ELISA, WB
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-93653
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
3047-CC
Species: Hu
Applications: BA
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DPSG10
Species: Hu
Applications: ELISA
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NBP3-13787
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB

Publications for MED14 Recombinant Protein Antigen (NBP2-56318PEP) (0)

There are no publications for MED14 Recombinant Protein Antigen (NBP2-56318PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED14 Recombinant Protein Antigen (NBP2-56318PEP) (0)

There are no reviews for MED14 Recombinant Protein Antigen (NBP2-56318PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED14 Recombinant Protein Antigen (NBP2-56318PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED14 Products

Array NBP2-56318PEP

Research Areas for MED14 Recombinant Protein Antigen (NBP2-56318PEP)

Find related products by research area.

Blogs on MED14

There are no specific blogs for MED14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED14 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED14