MED14 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MED14 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED14.

  Source: E. coli

  Amino Acid Sequence: PIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MED14
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56318.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 26 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED14 Recombinant Protein Antigen

• Activator-recruited cofactor 150 kDa component
• ARC150
• Cofactor required for Sp1 transcriptional activation subunit 2
• cofactor required for Sp1 transcriptional activation, subunit 2 (150kD)
• CRSP150
• CRSP2cofactor required for Sp1 transcriptional activation, subunit 2, 150kDa
• CSRP
• CXorf4MGC104513
• EXLM1CRSP complex subunit 2
• human homolog of yeast RGR1
• mediator complex subunit 14DRIP150
• mediator of RNA polymerase II transcription subunit 14
• RGR1RGR1 homolog
• Thyroid hormone receptor-associated protein complex 170 kDa component
• thyroid hormone receptor-associated protein complex component TRAP170
• Transcriptional coactivator CRSP150
• transcriptional co-activator CRSP150
• Trap170
• TRAP170hRGR1
• vitamin D receptor-interacting protein complex component DRIP150
• Vitamin D3 receptor-interacting protein complex 150 kDa component

Background

The activation of gene transcription is a multi-step process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multi-subunit complexes e.g. thyroid hormone receptor (TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MED14