MeCP2 Antibody (4B6)

Images

 
Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - Analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody (M01), clone 4B6.Lane 1: MECP2 transfected lysate(52.4 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: MeCP2 Antibody (4B6) [H00004204-M01] - Analysis of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.
Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6 Analysis of MECP2 expression in MCF-7.
Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6. Analysis of MECP2 expression in NIH/3T3.
Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6. Analysis of MECP2 expression in rat muscle.
Sandwich ELISA: MeCP2 Antibody (4B6) [H00004204-M01] - Detection limit for recombinant GST tagged MECP2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
4B6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MeCP2 Antibody (4B6) Summary

Immunogen
MECP2 (AAH11612, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
Marker
Nucleus Marker
Specificity
MECP2 - methyl CpG binding protein 2 (Rett syndrome)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MECP2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Control
MeCP2 Knockout HeLa Cell Lysate
Publications
Read Publications using H00004204-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MeCP2 Antibody (4B6)

  • AUTSX3
  • DKFZp686A24160
  • MeCp-2 protein
  • mental retardation, X-linked 79
  • methyl CpG binding protein 2 (Rett syndrome)
  • X-linked 16

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56519
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NBP1-84881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD
NB100-56630
Species: Hu
Applications: WB
NBP1-86087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, KO
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56534
Species: Hu, Mu
Applications: WB, ChIP, Flow, IHC, IHC-P, ICC
NBP2-03993
Species: Hu, Mu, Bv, Ca, Pm
Applications: WB
NB100-56603
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP
NBP1-91189
Species: Hu, Mu(-)
Applications: WB (-), ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01770
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for MeCP2 Antibody (H00004204-M01)(2)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for MeCP2 Antibody (H00004204-M01) (0)

There are no reviews for MeCP2 Antibody (H00004204-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MeCP2 Antibody (H00004204-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MeCP2 Products

Bioinformatics Tool for MeCP2 Antibody (H00004204-M01)

Discover related pathways, diseases and genes to MeCP2 Antibody (H00004204-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MeCP2 Antibody (H00004204-M01)

Discover more about diseases related to MeCP2 Antibody (H00004204-M01).
 

Pathways for MeCP2 Antibody (H00004204-M01)

View related products by pathway.

PTMs for MeCP2 Antibody (H00004204-M01)

Learn more about PTMs related to MeCP2 Antibody (H00004204-M01).
 

Research Areas for MeCP2 Antibody (H00004204-M01)

Find related products by research area.

Blogs on MeCP2.

New MECP2 Study Suggests Important Link to GABA
MECP2 antibodies are used in DNA methylation studies as well as research into Rett syndrome, a progressive neurological disorder caused by a mutation in the MECP2 gene. Now, a new study has been published by the laboratory where the Rett Syndrome gene...  Read full blog post.

Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MeCP2 Antibody (4B6) and receive a gift card or discount.

Bioinformatics

Gene Symbol MECP2
Entrez
OMIM
Uniprot