MeCP2 Antibody (4B6) - Azide and BSA Free

Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - Analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody (M01), clone 4B6.Lane 1: MECP2 transfected lysate(52.4 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: MeCP2 Antibody (4B6) [H00004204-M01] - Analysis of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. Antibody concentration 3 ug/ml.

Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6 Analysis of MECP2 expression in MCF-7.

Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6. Analysis of MECP2 expression in NIH/3T3.

Western Blot: MeCP2 Antibody (4B6) [H00004204-M01] - MECP2 monoclonal antibody (M01), clone 4B6. Analysis of MECP2 expression in rat muscle.

Sandwich ELISA: MeCP2 Antibody (4B6) [H00004204-M01] - Detection limit for recombinant GST tagged MECP2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 4B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MeCP2 Antibody (4B6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MECP2 (AAH11612, 81 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ
• Marker: Nucleus Marker
• Specificity: MECP2 - methyl CpG binding protein 2 (Rett syndrome)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MECP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MeCP2 Antibody (4B6) - Azide and BSA Free

• AUTSX3
• DKFZp686A24160
• MeCp-2 protein
• mental retardation, X-linked 79
• methyl CpG binding protein 2 (Rett syndrome)
• X-linked 16

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. In contrast to other MBD family members, MECP2 is X-linked and subject to X inactivation. MECP2 is dispensible in stem cells, but is essential for embryonic development. MECP2 gene mutations are the cause of some cases of Rett syndrome, a progressive neurologic developmental disorder and one of the most common causes of mental retardation in females.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MeCP2 Antibody (H00004204-M01)(2)

Publications using H00004204-M01

• Bueno C, Tabares-Seisdedos R, Moraleda JM, Martinez S Rett Syndrome Mutant Neural Cells Lacks MeCP2 Immunoreactive Bands. PLoS One 2016-04-11 [PMID: 27064487]
• Tai DJ, Liu YC, Hsu WL et al. MeCP2 SUMOylation rescues Mecp2-mutant-induced behavioural deficits in a mouse model of Rett syndrome. Nat Commun 2016-02-04 [PMID: 26842955] (WB)

Bioinformatics

• Gene Symbol: MECP2
• Entrez:
  • 4204(Human)
• OMIM:
  • 105830(Human)
• Uniprot:
  • AAH11612(Human)