MDR1/ABCB1 Antibody (1F11)

Images

 
ELISA: MDR1/ABCB1 Antibody (1F11) [H00005243-M01] - Detection limit for recombinant GST tagged ABCB1 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MDR1/ABCB1 Antibody (1F11) Summary

Immunogen
ABCB1 (NP_000918, 620 a.a. - 709 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRSSLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWP
Specificity
ABCB1 - ATP-binding cassette, sub-family B (MDR/TAP), member 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABCB1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MDR1/ABCB1 Antibody (1F11)

  • ABC20
  • ABCB1
  • ABCB1B
  • ATP-binding cassette sub-family B member 1
  • ATP-binding cassette, sub-family B (MDR/TAP), member 1
  • CD243 antigen
  • CD243
  • CLCS
  • colchicin sensitivity
  • doxorubicin resistance
  • EC 3.6.3
  • EC 3.6.3.44
  • GP170
  • IBD13
  • MDR1
  • MDR1MGC163296
  • multidrug resistance protein 1
  • P-glycoprotein 1
  • P-gp
  • PGY1
  • PGY1P-GP

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood-brain barrier.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38160
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57299
Species: Hu
Applications: WB, ICC/IF, IHC-P
AF6278
Species: Hu, Mu
Applications: WB
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-30887
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF

Publications for MDR1/ABCB1 Antibody (H00005243-M01) (0)

There are no publications for MDR1/ABCB1 Antibody (H00005243-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDR1/ABCB1 Antibody (H00005243-M01) (0)

There are no reviews for MDR1/ABCB1 Antibody (H00005243-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDR1/ABCB1 Antibody (H00005243-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDR1/ABCB1 Products

Bioinformatics Tool for MDR1/ABCB1 Antibody (H00005243-M01)

Discover related pathways, diseases and genes to MDR1/ABCB1 Antibody (H00005243-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDR1/ABCB1 Antibody (H00005243-M01)

Discover more about diseases related to MDR1/ABCB1 Antibody (H00005243-M01).
 

Pathways for MDR1/ABCB1 Antibody (H00005243-M01)

View related products by pathway.

PTMs for MDR1/ABCB1 Antibody (H00005243-M01)

Learn more about PTMs related to MDR1/ABCB1 Antibody (H00005243-M01).
 

Research Areas for MDR1/ABCB1 Antibody (H00005243-M01)

Find related products by research area.

Blogs on MDR1/ABCB1

There are no specific blogs for MDR1/ABCB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDR1/ABCB1 Antibody (1F11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB1
Entrez
OMIM
Uniprot