MDM1 Antibody

Images

 
Immunohistochemistry-Paraffin: MDM1 Antibody [NBP1-86242] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MDM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NNEGVTNHTPVNENVELEHSTKVLSENVDNGLDRLLRKKAGLTVVPSYNALRNSEYQRQFVWKTSKETAPAFAANQVFHNKSQFVPPFKGNSVIHETEYKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MDM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MDM1 Protein (NBP1-86242PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MDM1 Antibody

  • FLJ95264
  • Mdm1 nuclear protein homolog (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein (mouse)
  • Mdm4, transformed 3T3 cell double minute 1, p53 binding protein
  • nuclear protein double minute 1
  • nuclear protein MDM1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
H00000825-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-52030
Species: Hu
Applications: WB, PEP-ELISA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-31983
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54974
Species: Hu
Applications: WB
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1591
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-32284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86286
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86242
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MDM1 Antibody (NBP1-86242) (0)

There are no publications for MDM1 Antibody (NBP1-86242).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDM1 Antibody (NBP1-86242) (0)

There are no reviews for MDM1 Antibody (NBP1-86242). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MDM1 Antibody (NBP1-86242) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MDM1 Products

Bioinformatics Tool for MDM1 Antibody (NBP1-86242)

Discover related pathways, diseases and genes to MDM1 Antibody (NBP1-86242). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MDM1 Antibody (NBP1-86242)

Discover more about diseases related to MDM1 Antibody (NBP1-86242).
 

Pathways for MDM1 Antibody (NBP1-86242)

View related products by pathway.

PTMs for MDM1 Antibody (NBP1-86242)

Learn more about PTMs related to MDM1 Antibody (NBP1-86242).

Blogs on MDM1

There are no specific blogs for MDM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MDM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MDM1