Recombinant Human MDA5 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human MDA5 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-221 of Human IFIH1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAGICNFTEEDSSNSA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
IFIH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
51.5 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MDA5 GST (N-Term) Protein

  • AGS7
  • CADM-140 autoantigen
  • Clinically amyopathic dermatomyositis autoantigen 140 kDa
  • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide
  • EC 3.6.4.13
  • Helicard
  • Helicase with 2 CARD domains
  • Hlcd
  • IDDM19
  • IFIH1
  • IMD95
  • interferon induced with helicase C domain 1
  • interferon-induced helicase C domain-containing protein 1
  • Interferon-induced with helicase C domain protein 1
  • MDA5
  • MDA-5
  • MDA-5MGC133047
  • MDA5RNA helicase-DEAD box protein 116
  • melanoma differentiation associated protein-5
  • Melanoma differentiation-associated protein 5
  • Murabutide down-regulated protein
  • RH116
  • SGMRT1

Background

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-77275
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-85348
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
8499-IF
Species: Hu
Applications: BA
NBP2-47415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-75930
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
NBP2-24906
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, Simple Western, WB
MAB1980
Species: Hu
Applications: ICC, IP, Simple Western, WB
AF8519
Species: Hu, Mu, Rt
Applications: Simple Western, WB
DIP100
Species: Hu
Applications: ELISA
NB100-56705
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
AF6139
Species: Hu
Applications: ICC
H00064135-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for MDA5 Recombinant Protein (H00064135-P01) (0)

There are no publications for MDA5 Recombinant Protein (H00064135-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDA5 Recombinant Protein (H00064135-P01) (0)

There are no reviews for MDA5 Recombinant Protein (H00064135-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/Â¥70 Yuan/Â¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/Â¥150 Yuan/Â¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MDA5 Recombinant Protein (H00064135-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MDA5 Products

Research Areas for MDA5 Recombinant Protein (H00064135-P01)

Find related products by research area.

Blogs on MDA5.


  Read full blog post.

MDA5 - Part of the RIG-I-like Receptor Family
The innate immune system is responsible for reacting to viral infections through recognition of various viral components. Like toll-like receptor 3 (TLR3), MDA5 recognizes double-stranded (ds) RNA which is a molecular pattern indicative of viral infec...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MDA5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IFIH1