MCM6 Recombinant Protein Antigen

Images

 
There are currently no images for MCM6 Protein (NBP1-82642PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MCM6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCM6.

Source: E. coli

Amino Acid Sequence: VILRAEAVESAQAGDKCDFTGTLIVVPDVSKLSTPGARAETNSRVSGVDGYETEGIRGLRALGVRDLSYRLVFLACCVAPTNPRFGGKELRDEEQTAESIKNQMTVKEWEKVFEMSQDKNLYHNLCTSLFPTIHGNDEVKRGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MCM6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82642.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCM6 Recombinant Protein Antigen

  • DNA replication licensing factor MCM6
  • EC 3.6.4.12
  • MCG40308
  • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe) (S.cerevisiae)
  • MCM6 minichromosome maintenance deficient 6 (MIS5 homolog, S. pombe)
  • minichromosome maintenance complex component 6
  • minichromosome maintenance deficient (mis5, S. pombe) 6
  • minichromosome maintenance deficient 6 homolog (S. cerevisiae)
  • minichromosome maintenance deficient 6 homolog
  • MIS5 homolog
  • Mis5
  • p105MCM

Background

MCM6 is encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NB100-288
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-79778
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-15386
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-12238
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-2567
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP1-85723
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00051053-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-45326
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB

Publications for MCM6 Protein (NBP1-82642PEP) (0)

There are no publications for MCM6 Protein (NBP1-82642PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM6 Protein (NBP1-82642PEP) (0)

There are no reviews for MCM6 Protein (NBP1-82642PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCM6 Protein (NBP1-82642PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCM6 Products

Research Areas for MCM6 Protein (NBP1-82642PEP)

Find related products by research area.

Blogs on MCM6.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MCM6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM6