We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MCM5 Recombinant Protein Antigen

Images

 
There are currently no images for MCM5 Recombinant Protein Antigen (NBP2-55587PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MCM5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MCM5.

Source: E. coli

Amino Acid Sequence: GYALPRKCNTDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLTTSRGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGAVSPQEEEEFRRLAALPNVYE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MCM5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55587.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MCM5 Recombinant Protein Antigen

  • CDC46 homolog
  • CDC46DNA replication licensing factor MCM5
  • EC 3.6.4.12
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46 (S.cerevisiae)
  • MCM5 minichromosome maintenance deficient 5, cell division cycle 46
  • MGC5315
  • minichromosome maintenance complex component 5
  • minichromosome maintenance deficient (S. cerevisiae) 5 (cell division cycle 46)
  • minichromosome maintenance deficient 5 (cell division cycle 46)
  • P1-CDC46

Background

MCM5 (Mini Chromosome Maintenance protein-5) is involved in the control of DNA replication. MCM proteins have DNA dependent ATPase motifs in their central domain which is conserved from yeast to mammals. MCM proteins form a complex which exhibits ATPase and helicase activities. In G0 phase levels of MCM 2 and 5 are lower than that of MCM7 and 3 but increase as the cell enters G1/S phase of the cell cycle. It has been reported that immunocytochemical assessment of Mcm5 expression may be of value in improving the accuracy of cervical smear testing for the detection of malignancy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004176-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-288
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-33105
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-15386
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-82642
Species: Hu, Mu, Rt
Applications: CHIP-SEQ, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-15837
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85723
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-32708
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-47902
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-30949
Species: Hu
Applications: IHC,  IHC-P
NBP1-97512
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-44520
Species: Ca(-), Hu, Rt(-)
Applications: ICC/IF, IF, IHC,  IHC-P, MI, WB
NBP1-81293
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-62583
Species: Hu
Applications: WB
NB100-74635
Species: Hu
Applications: IHC,  IHC-P, IP, WB (-)

Publications for MCM5 Recombinant Protein Antigen (NBP2-55587PEP) (0)

There are no publications for MCM5 Recombinant Protein Antigen (NBP2-55587PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCM5 Recombinant Protein Antigen (NBP2-55587PEP) (0)

There are no reviews for MCM5 Recombinant Protein Antigen (NBP2-55587PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MCM5 Recombinant Protein Antigen (NBP2-55587PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MCM5 Products

Research Areas for MCM5 Recombinant Protein Antigen (NBP2-55587PEP)

Find related products by research area.

Blogs on MCM5

There are no specific blogs for MCM5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MCM5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MCM5