Recombinant Human MBNL2 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MBNL2 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-80 of Human MBNL2

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MBNL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
34.54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MBNL2 GST (N-Term) Protein

  • DKFZp781H1296
  • MBLL39Muscleblind-like protein 1
  • MBLLMGC120628
  • MGC120625
  • MGC120626
  • MLP1
  • muscleblind-like 2 (Drosophila)
  • muscleblind-like protein 2
  • Muscleblind-like protein-like 39
  • Muscleblind-like protein-like
  • PRO2032

Background

This gene encodes a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein. Drosophila muscleblind is a gene required for photoreceptor differentiation. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004154-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
MAB6967
Species: Hu
Applications: WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85635
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, PEP-ELISA
NBP1-69124
Species: Mu, Rt
Applications: WB, IHC
NBP2-19462
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-2866
Species: Hu
Applications: WB, ICC/IF, IP, KD
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB200-316
Species: Hu, Mu, Rt, Po, Bv, Pm, Rb
Applications: WB, Simple Western, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56590
Species: Hu, Rt
Applications: WB, IHC, IF
NBP2-45731
Species: All-NA
Applications: WB, IHC, IHC-P
NBP1-31649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-85519
Species: Hu, Mu
Applications: WB, ELISA, IHC, IP, KD
H00010150-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for MBNL2 Partial Recombinant Protein (H00010150-Q01) (0)

There are no publications for MBNL2 Partial Recombinant Protein (H00010150-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBNL2 Partial Recombinant Protein (H00010150-Q01) (0)

There are no reviews for MBNL2 Partial Recombinant Protein (H00010150-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBNL2 Partial Recombinant Protein (H00010150-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional MBNL2 Products

Bioinformatics Tool for MBNL2 Partial Recombinant Protein (H00010150-Q01)

Discover related pathways, diseases and genes to MBNL2 Partial Recombinant Protein (H00010150-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBNL2 Partial Recombinant Protein (H00010150-Q01)

Discover more about diseases related to MBNL2 Partial Recombinant Protein (H00010150-Q01).
 

Pathways for MBNL2 Partial Recombinant Protein (H00010150-Q01)

View related products by pathway.

Blogs on MBNL2

There are no specific blogs for MBNL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MBNL2 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MBNL2