MBD4 Recombinant Protein Antigen

Images

 
There are currently no images for MBD4 Recombinant Protein Antigen (NBP3-21219PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MBD4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MBD4

Source: E.coli

Amino Acid Sequence: LQNQSNNSNWNLRTRSKCKKDVFMPPSSSSELQESRGLSNFTSTHLLLKEDEGVDDVNFRKVRKPKGKVTILKGIPIKKTKKGCRKSCSGFVQSDSKRESVCNKADAESEPVAQKSQLDRTVCISDAGACGETLSVTSEEN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MBD4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21219. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MBD4 Recombinant Protein Antigen

  • EC 3.2.2.-
  • G/T mismatch glycosylase
  • G/U mismatch glycosylase
  • MBD4
  • MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics
  • methyl-CpG binding domain protein 4
  • methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase
  • Methyl-CpG-binding endonuclease 1
  • Methyl-CpG-binding protein MBD4
  • Mismatch-specific DNA N-glycosylase
  • putative methyl-CpG binding protein

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MBD4 may function to mediate the biological consequences of the methylation signal. In addition, MBD4 has protein sequence similarity to bacterial DNA repair enzymes and thus may have some function in DNA repair. Further, MBD4 gene mutations are detected in tumors with primary microsatellite-instability (MSI), a form of genomic instability associated with defective DNA mismatch repair, and MBD4 gene meets 4 of 5 criteria of a bona fide MIS target gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67381
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
DCDL40
Species: Hu
Applications: ELISA
H00000054-D01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
MAB3277
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
NB100-81657
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NB600-636
Species: Ca, Hu, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-92242
Species: Hu, Mu, Rt
Applications: WB
NB100-56537
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1020
Species: Hu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DY393
Species: Hu
Applications: ELISA
AF6270
Species: Hu
Applications: ICC
NB600-1031
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for MBD4 Recombinant Protein Antigen (NBP3-21219PEP) (0)

There are no publications for MBD4 Recombinant Protein Antigen (NBP3-21219PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD4 Recombinant Protein Antigen (NBP3-21219PEP) (0)

There are no reviews for MBD4 Recombinant Protein Antigen (NBP3-21219PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MBD4 Recombinant Protein Antigen (NBP3-21219PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MBD4 Products

Array NBP3-21219PEP

Research Areas for MBD4 Recombinant Protein Antigen (NBP3-21219PEP)

Find related products by research area.

Blogs on MBD4

There are no specific blogs for MBD4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MBD4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MBD4