MAZ Antibody (6G2)

Images

 
Western Blot: MAZ Antibody (6G2) [H00004150-M05] - Western Blot analysis of MAZ expression in Hela NE ( Cat # L013V3 ).
ELISA: MAZ Antibody (6G2) [H00004150-M05] - Detection limit for recombinant GST tagged MAZ is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
6G2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAZ Antibody (6G2) Summary

Immunogen
MAZ (NP_002374 332 a.a. - 440 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YQCPVCQQRFKRKDRMSYHVRSHDGAVHKPYNCSHCGKSFSRPDHLNSHVRQVHSTERPFKCEKCEAAFATKDRLRAHTVRHEEKVPCHVCGKMLSSAYISDHMKVHSQ
Specificity
MAZ (6G2)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAZ Antibody (6G2)

  • MAZI
  • MYC-associated zinc finger protein (purine-binding transcription factor)
  • myc-associated zinc finger protein
  • PUR1
  • Pur-1SAF-2
  • Purine-binding transcription factor
  • serum amyloid A activating factor 1
  • serum amyloid A activating factor 2
  • Transcription factor Zif87
  • ZF87SAF-1
  • Zif87
  • Zinc finger protein 801
  • zinc-finger protein, 87 kilodaltons
  • ZNF801SAF-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00688
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-35213
Species: Hu
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for MAZ Antibody (H00004150-M05) (0)

There are no publications for MAZ Antibody (H00004150-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAZ Antibody (H00004150-M05) (0)

There are no reviews for MAZ Antibody (H00004150-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAZ Antibody (H00004150-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAZ Products

Bioinformatics Tool for MAZ Antibody (H00004150-M05)

Discover related pathways, diseases and genes to MAZ Antibody (H00004150-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAZ Antibody (H00004150-M05)

Discover more about diseases related to MAZ Antibody (H00004150-M05).
 

Pathways for MAZ Antibody (H00004150-M05)

View related products by pathway.

PTMs for MAZ Antibody (H00004150-M05)

Learn more about PTMs related to MAZ Antibody (H00004150-M05).

Blogs on MAZ

There are no specific blogs for MAZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAZ Antibody (6G2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MAZ
Entrez
OMIM
Uniprot