Recombinant Human MATK Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MATK Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human MATK

Source: Wheat Germ

Amino Acid Sequence: MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFRKGDVVTILEACENKSWYRVKHHTSGQEGLL

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MATK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MATK Protein

  • CHK
  • Csk-type protein tyrosine kinase
  • CTKEC 2.7.10.2
  • DKFZp434N1212
  • EC 2.7.10
  • Hematopoietic consensus tyrosine-lacking kinase
  • HHYLTK
  • hydroxyaryl-protein kinase
  • HYL tyrosine kinase
  • HYLCsk-homologous kinase
  • HYLTK
  • leukocyte carboxyl-terminal src kinase related
  • Lsk
  • megakaryocyte-associated tyrosine kinase
  • megakaryocyte-associated tyrosine-protein kinase
  • MGC1708
  • MGC2101
  • Protein kinase HYL
  • tyrosine kinase MATK
  • Tyrosine-protein kinase CTK
  • tyrosylprotein kinase

Background

MATK - megakaryocyte-associated tyrosine kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1768
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
AF1626
Species: Hu
Applications: WB, ICC
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF3206
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-32384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-90816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP

Publications for MATK Partial Recombinant Protein (H00004145-Q01) (0)

There are no publications for MATK Partial Recombinant Protein (H00004145-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MATK Partial Recombinant Protein (H00004145-Q01) (0)

There are no reviews for MATK Partial Recombinant Protein (H00004145-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MATK Partial Recombinant Protein (H00004145-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MATK Partial Recombinant Protein (H00004145-Q01)

Discover related pathways, diseases and genes to MATK Partial Recombinant Protein (H00004145-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MATK Partial Recombinant Protein (H00004145-Q01)

Discover more about diseases related to MATK Partial Recombinant Protein (H00004145-Q01).
 

Pathways for MATK Partial Recombinant Protein (H00004145-Q01)

View related products by pathway.

PTMs for MATK Partial Recombinant Protein (H00004145-Q01)

Learn more about PTMs related to MATK Partial Recombinant Protein (H00004145-Q01).
 

Research Areas for MATK Partial Recombinant Protein (H00004145-Q01)

Find related products by research area.

Blogs on MATK

There are no specific blogs for MATK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MATK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MATK