MASL1 Antibody


Western Blot: MASL1 Antibody [NBP2-30382] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MASL1 Antibody [NBP2-30382] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry: MASL1 Antibody [NBP2-30382] - Staining of human rectum shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MASL1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHR
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (90%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MASL1 Protein (NBP2-30382PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MASL1 Antibody

  • Leucine Rich Repeat Containing 65
  • LRRC65
  • Malignant Fibrous Histiocytoma Amplified Sequence 1
  • Malignant Fibrous Histiocytoma-Amplified Sequence 1
  • Malignant Fibrous Histiocytoma-Amplified Sequence With Leucine-Rich Tandem
  • MFH-Amplified Sequences With Leucine-Rich Tandem Repeats 1
  • MFHAS1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC-P, IP
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Mu
Applications: WB, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC, IP
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MASL1 Antibody (NBP2-30382) (0)

There are no publications for MASL1 Antibody (NBP2-30382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MASL1 Antibody (NBP2-30382) (0)

There are no reviews for MASL1 Antibody (NBP2-30382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MASL1 Antibody (NBP2-30382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MASL1 Products

MASL1 NBP2-30382

Bioinformatics Tool for MASL1 Antibody (NBP2-30382)

Discover related pathways, diseases and genes to MASL1 Antibody (NBP2-30382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MASL1 Antibody (NBP2-30382)

Discover more about diseases related to MASL1 Antibody (NBP2-30382).

Pathways for MASL1 Antibody (NBP2-30382)

View related products by pathway.

PTMs for MASL1 Antibody (NBP2-30382)

Learn more about PTMs related to MASL1 Antibody (NBP2-30382).

Blogs on MASL1

There are no specific blogs for MASL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MASL1 Antibody and receive a gift card or discount.


Gene Symbol MFHAS1