MAS1L Antibody - Azide and BSA Free

Western Blot: MAS1L Antibody [NBP3-04772] - Analysis of extracts of HepG2 cells, using MAS1L antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit .

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAS1L Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MAS1L Antibody - Azide and BSA Free (NBP3-04772) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAS1L (NP_443199.1). MVWGKICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAS1L
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 42 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MAS1L Antibody - Azide and BSA Free

• DJ994E9.2
• MAS1 Oncogene-Like
• MAS1L
• MAS1-Like
• MAS-L
• MAS-R
• mas-related G protein-coupled MRG
• Mas-Related G-Protein Coupled Receptor MRG
• MRG
• MRGMGC119987

Background

MRG is an Orphan-A GPCR with an unknown ligand highly similar to other MRG receptors. It is most similar to the product of the MAS protooncogene, which controls cellular responses to angiotensin. MRG has been reported absent in the adrenal, liver, kidney, and vascular smooth muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MAS1L