MAS1L Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAS1L Antibody [NBP1-85157] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.

Immunohistochemistry-Paraffin: MAS1L Antibody [NBP1-85157] - Staining of human testis shows strong positivity in basal cells of ductus seminiferus.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAS1L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAS1L Antibody - BSA Free (NBP1-85157) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ICWFSQRAGWTVFAESQISLSCSLCLHSGDQEAQNPNLVSQLCGVFLQNETNETIHMQMSMAVGQQALPLNIIA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAS1L
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAS1L Protein (NBP1-85157PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MAS1L Antibody - BSA Free

• DJ994E9.2
• MAS1 Oncogene-Like
• MAS1L
• MAS1-Like
• MAS-L
• MAS-R
• mas-related G protein-coupled MRG
• Mas-Related G-Protein Coupled Receptor MRG
• MRG
• MRGMGC119987

Background

MRG is an Orphan-A GPCR with an unknown ligand highly similar to other MRG receptors. It is most similar to the product of the MAS protooncogene, which controls cellular responses to angiotensin. MRG has been reported absent in the adrenal, liver, kidney, and vascular smooth muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAS1L