Mas Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Mas Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mas
  
  

  Source: E.coli

  Amino Acid Sequence: SKKKRFKESLKVVLTRAFKDEMQPRRQKDNCNTVTVETVV

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MAS1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17188It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mas Recombinant Protein Antigen

• Mas
• MAS1 oncogene
• MAS1
• MGC119966
• proto-oncogene Mas

Background

The MAS1 product is highly similar to other MRG receptors. This receptor has been suggested to affect the blood pressure control and body fluid homeostasis in the renin-angiotensis system. Mas proto-oncogene has been reported in brain, breast, eye, heart, kidney, and testis. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth regulating pathway to bring about oncogenic effects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAS1