MARVELD2 Antibody - BSA Free Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human MARVELD2 (NP_001033692.2).
Sequence: ELLLGAGVFACVTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MARVELD2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
64 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MARVELD2 Antibody - BSA Free
Background
Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts (Ikenouchi et al., 2005 [PubMed 16365161]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA
Publications for MARVELD2 Antibody (NBP3-35481) (0)
There are no publications for MARVELD2 Antibody (NBP3-35481).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MARVELD2 Antibody (NBP3-35481) (0)
There are no reviews for MARVELD2 Antibody (NBP3-35481).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MARVELD2 Antibody (NBP3-35481) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MARVELD2 Products
Blogs on MARVELD2