MARVELD2 Antibody

Images

 
Immunohistochemistry: MARVELD2 Antibody [NBP2-14222] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARVELD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRL PHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRI QEYDKVMNWDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARVELD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MARVELD2 Protein (NBP2-14222PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MARVELD2 Antibody

  • MARVEL domain containing 2
  • MRVLDC2
  • TRICautosomal recessive 49

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-97505
Species: Hu, Mu, Rt, Po, Bv, Ce, Ca, Dr, GP, Pl, Pm, Rb, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-13798
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-59494
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89631
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB120-15106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-86562
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13452
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for MARVELD2 Antibody (NBP2-14222) (0)

There are no publications for MARVELD2 Antibody (NBP2-14222).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARVELD2 Antibody (NBP2-14222) (0)

There are no reviews for MARVELD2 Antibody (NBP2-14222). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MARVELD2 Antibody (NBP2-14222) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MARVELD2 Products

Bioinformatics Tool for MARVELD2 Antibody (NBP2-14222)

Discover related pathways, diseases and genes to MARVELD2 Antibody (NBP2-14222). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARVELD2 Antibody (NBP2-14222)

Discover more about diseases related to MARVELD2 Antibody (NBP2-14222).
 

Pathways for MARVELD2 Antibody (NBP2-14222)

View related products by pathway.

PTMs for MARVELD2 Antibody (NBP2-14222)

Learn more about PTMs related to MARVELD2 Antibody (NBP2-14222).

Blogs on MARVELD2

There are no specific blogs for MARVELD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARVELD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARVELD2