Mark3 Recombinant Protein Antigen

Images

 
There are currently no images for Mark3 Protein (NBP1-85389PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Mark3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MARK3.

Source: E. coli

Amino Acid Sequence: QSPHHKVQRSVSSSQKQRRYSDHAGPAIPSVVAYPKRSQTSTADSDLKEDGISSRKSSGSAVGGKGIAPASPMLGNASNPNKADIPERKKSSTVPSSNTASGGMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MARK3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85389.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mark3 Recombinant Protein Antigen

  • Cdc25C-associated protein kinase 1
  • cTAK1
  • C-TAK1
  • CTAK1ELKL motif kinase 2
  • EC 2.7.11
  • EC 2.7.11.1
  • EMK2
  • EMK-2
  • KP78
  • MAP/microtubule affinity-regulating kinase 3
  • PAR1A
  • Protein kinase STK10
  • Ser/Thr protein kinase PAR-1
  • Serine/threonine-protein kinase p78

Background

MARK3 is a dual-specificity protein kinase that controls entry into mitosis by dephosphorylating Cdc2 on both threonine 14 and tyrosine 15. MARK3 is phosphorylated on serine 216 throughout interphase but not during mitosis. Serine 216 phosphorylation mediates the binding of 14-3-3 protein to MARK3, and MARK3/14-3-3 complexes are present throughout interphase but not during mitosis (1). Kinase suppressor of Ras (KSR) is a conserved component of the Ras pathway that interacts directly with MEK and MAPK. It has been shown that KSR1 translocates from the cytoplasm to the cell surface in response to growth factor treatment and that this process is regulated by MARK3 (2). MARK3 seems to be a positive regulator of the beta-catenin pathway and an inhibitor of the JNK pathway. These findings show that MARK3, a regulator of polarity, is also a modulator of Wnt-beta-catenin signalling, indicating a link between two important developmental pathways (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002011-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-33409
Species: Hu
Applications: ICC/IF, WB
MAB4459
Species: Hu, Mu, Rt
Applications: WB
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-14835
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45755
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-32512
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF5769
Species: Hu
Applications: IHC, WB
NBP2-49382
Species: Hu
Applications: IHC,  IHC-P
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
NBP1-19083
Species: Hu
Applications: ICC/IF, WB
NBP1-85389PEP
Species: Hu
Applications: AC

Publications for Mark3 Protein (NBP1-85389PEP) (0)

There are no publications for Mark3 Protein (NBP1-85389PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mark3 Protein (NBP1-85389PEP) (0)

There are no reviews for Mark3 Protein (NBP1-85389PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Mark3 Protein (NBP1-85389PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mark3 Products

Research Areas for Mark3 Protein (NBP1-85389PEP)

Find related products by research area.

Blogs on Mark3

There are no specific blogs for Mark3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Mark3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MARK3