Recombinant Human MARCH2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MARCH2 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 99 of Human MARCH2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MARCH2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MARCH2 Protein

  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH-IIHSPC240
  • membrane-associated ring finger (C3HC4) 2
  • Membrane-associated RING finger protein 2
  • Membrane-associated RING-CH protein II
  • RING finger protein 172
  • RNF172E3 ubiquitin-protein ligase MARCH2

Background

MARCH2 - membrane-associated ring finger (C3HC4) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
AF5664
Species: Hu
Applications: WB, IHC, ICC
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21583
Species: Hu
Applications: WB, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NB110-55288
Species: Hu, Mu, Rt, Fi, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-81260
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-1260
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-02477
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF4377
Species: Hu, Mu
Applications: WB, ICC
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for MARCH2 Partial Recombinant Protein (H00051257-Q01) (0)

There are no publications for MARCH2 Partial Recombinant Protein (H00051257-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH2 Partial Recombinant Protein (H00051257-Q01) (0)

There are no reviews for MARCH2 Partial Recombinant Protein (H00051257-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH2 Partial Recombinant Protein (H00051257-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MARCH2 Products

Bioinformatics Tool for MARCH2 Partial Recombinant Protein (H00051257-Q01)

Discover related pathways, diseases and genes to MARCH2 Partial Recombinant Protein (H00051257-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH2 Partial Recombinant Protein (H00051257-Q01)

Discover more about diseases related to MARCH2 Partial Recombinant Protein (H00051257-Q01).
 

Pathways for MARCH2 Partial Recombinant Protein (H00051257-Q01)

View related products by pathway.

PTMs for MARCH2 Partial Recombinant Protein (H00051257-Q01)

Learn more about PTMs related to MARCH2 Partial Recombinant Protein (H00051257-Q01).
 

Research Areas for MARCH2 Partial Recombinant Protein (H00051257-Q01)

Find related products by research area.

Blogs on MARCH2

There are no specific blogs for MARCH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MARCH2 Antibody
NBP1-91638
DRP1 Antibody
NB110-55288

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MARCH2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH2