MAPKBP1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MAPKBP1 Antibody [NBP2-38164] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.

Immunohistochemistry-Paraffin: MAPKBP1 Antibody [NBP2-38164] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry: MAPKBP1 Antibody [NBP2-38164] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: MAPKBP1 Antibody [NBP2-38164] - Staining in human testis and pancreas tissues using anti-MAPKBP1 antibody. Corresponding MAPKBP1 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MAPKBP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MAPKBP1 Antibody - BSA Free (NBP2-38164) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSSPQRASGPNRHQAPSMLSPGPALSSDSDKEGEDEGTEEELPALPVLAKSTKKALASVPSPALPRSLSHWEMSRAQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPKBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MAPKBP1 Protein (NBP2-38164PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAPKBP1 Antibody - BSA Free

• AOA1EAOH
• AOAMGC1072
• aprataxin
• ataxia 1, early onset with hypoalbuminemia
• AXA1
• EC 3.-
• EOAHA
• FHA-HIT
• FLJ20157
• Forkhead-associated domain histidine triad-like protein

Background

MAPKBP1 is involved in JNK signaling pathway

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPKBP1
• Uniprot:
  • O60336(Human)