MAPKBP1 Antibody

Images

 
Immunohistochemistry-Paraffin: MAPKBP1 Antibody [NBP1-82984] - Staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAPKBP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLSVDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSPQTPDQEQFLKQHFETLA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPKBP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAPKBP1 Protein (NBP1-82984PEP)
Publications
Read Publication using NBP1-82984.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22700971)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAPKBP1 Antibody

  • AOA1EAOH
  • AOAMGC1072
  • aprataxin
  • ataxia 1, early onset with hypoalbuminemia
  • AXA1
  • EC 3.-
  • EOAHA
  • FHA-HIT
  • FLJ20157
  • Forkhead-associated domain histidine triad-like protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56363
Species: Hu, Mu
Applications: WB
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-26506
Species: Hu, Mu, Rt
AF6380
Species: Mu
Applications: WB
NBP2-46228
Species: Hu
Applications: WB, IHC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-56928
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
H00008767-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-82984
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for MAPKBP1 Antibody (NBP1-82984)(1)

Reviews for MAPKBP1 Antibody (NBP1-82984) (0)

There are no reviews for MAPKBP1 Antibody (NBP1-82984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAPKBP1 Antibody (NBP1-82984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAPKBP1 Products

Bioinformatics Tool for MAPKBP1 Antibody (NBP1-82984)

Discover related pathways, diseases and genes to MAPKBP1 Antibody (NBP1-82984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPKBP1 Antibody (NBP1-82984)

Discover more about diseases related to MAPKBP1 Antibody (NBP1-82984).
 

Pathways for MAPKBP1 Antibody (NBP1-82984)

View related products by pathway.

PTMs for MAPKBP1 Antibody (NBP1-82984)

Learn more about PTMs related to MAPKBP1 Antibody (NBP1-82984).

Blogs on MAPKBP1

There are no specific blogs for MAPKBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAPKBP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKBP1