MAPKAPK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAPKAPK2 Antibody [NBP2-58247] - Staining of human cell line MCF7 shows localization to nucleoplasm & centrosome.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAPKAPK2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
Specificity
Specificity of human MAPKAPK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAPKAPK2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAPKAPK2 Recombinant Protein Antigen (NBP2-58247PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MAPKAPK2 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • MAP kinase-activated protein kinase 2
  • MAPK-activated protein kinase 2
  • MAPKAP kinase 2
  • MAPKAPK2
  • MAPKAPK-2
  • mitogen-activated protein kinase-activated protein kinase 2
  • MK2
  • Rps6kc1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP1-75477
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-87231
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for MAPKAPK2 Antibody (NBP2-58247) (0)

There are no publications for MAPKAPK2 Antibody (NBP2-58247).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPKAPK2 Antibody (NBP2-58247) (0)

There are no reviews for MAPKAPK2 Antibody (NBP2-58247). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAPKAPK2 Antibody (NBP2-58247) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MAPKAPK2 Antibody (NBP2-58247)

Discover related pathways, diseases and genes to MAPKAPK2 Antibody (NBP2-58247). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPKAPK2 Antibody (NBP2-58247)

Discover more about diseases related to MAPKAPK2 Antibody (NBP2-58247).
 

Pathways for MAPKAPK2 Antibody (NBP2-58247)

View related products by pathway.

PTMs for MAPKAPK2 Antibody (NBP2-58247)

Learn more about PTMs related to MAPKAPK2 Antibody (NBP2-58247).
 

Research Areas for MAPKAPK2 Antibody (NBP2-58247)

Find related products by research area.

Blogs on MAPKAPK2

There are no specific blogs for MAPKAPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAPKAPK2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPKAPK2
Entrez