MAPK15 Antibody

Images

 
Western Blot: MAPK15 Antibody [H00225689-B01P] - Analysis of MAPK15 expression in transfected 293T cell line by MAPK15 polyclonal antibody. Lane 1: MAPK15 transfected lysate(30.58 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MAPK15 Antibody Summary

Immunogen
MAPK15 (AAH28034, 1 a.a. - 277 a.a.) full-length human protein. MCTVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMGCPPSPPPPTAVRTLSADTDLNAVIRKGGLLQDVHVRSIFYQLLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVATRWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEEDLLALGSGCRASVLHQLGSR
Specificity
MAPK15 - mitogen-activated protein kinase 15,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MAPK15
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAPK15 Antibody

  • EC 2.7.11
  • ERK-7
  • ERK7MAPK 15
  • ERK-8
  • ERK8EC 2.7.11.24
  • extracellular regulated kinase 8 delta
  • extracellular signal regulated kinase 8
  • Extracellular signal-regulated kinase 7
  • Extracellular signal-regulated kinase 8
  • MAP kinase 15
  • mitogen-activated protein kinase 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1230
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5626
Species: Hu
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
H00010598-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
MAB3196
Species: Hu
Applications: WB, IHC
NBP2-45743
Species: Hu
Applications: WB, IHC, IF
MAB4640
Species: Hu
Applications: WB
NB500-138
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, Gp, Rb, Sh, Ye
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, B/N
H00225689-B01P
Species: Hu
Applications: WB

Publications for MAPK15 Antibody (H00225689-B01P) (0)

There are no publications for MAPK15 Antibody (H00225689-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPK15 Antibody (H00225689-B01P) (0)

There are no reviews for MAPK15 Antibody (H00225689-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAPK15 Antibody (H00225689-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MAPK15 Products

Bioinformatics Tool for MAPK15 Antibody (H00225689-B01P)

Discover related pathways, diseases and genes to MAPK15 Antibody (H00225689-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPK15 Antibody (H00225689-B01P)

Discover more about diseases related to MAPK15 Antibody (H00225689-B01P).
 

Pathways for MAPK15 Antibody (H00225689-B01P)

View related products by pathway.

PTMs for MAPK15 Antibody (H00225689-B01P)

Learn more about PTMs related to MAPK15 Antibody (H00225689-B01P).

Blogs on MAPK15

There are no specific blogs for MAPK15, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAPK15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK15
Entrez
Uniprot