MAGEA4 Antibody (3D12) - Azide and BSA Free

Western Blot: MAGEA4 Antibody (3D12) [H00004103-M01] - MAGEA4 monoclonal antibody (M01), clone 3D12 Analysis of MAGEA4 expression in Hela S3 NE.

Immunocytochemistry/Immunofluorescence: MAGEA4 Antibody (3D12) [H00004103-M01] - Analysis of monoclonal antibody to MAGEA4 on HeLa cell. Antibody concentration 10 ug/ml.

Sandwich ELISA: MAGEA4 Antibody (3D12) [H00004103-M01] - Detection limit for recombinant GST tagged MAGEA4 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 3D12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MAGEA4 Antibody (3D12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MAGEA4 (NP_002353, 98 a.a. ~ 171 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVD
• Specificity: melanoma antigen family A, 4
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MAGEA4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate for WB. It has been used for IF and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAGEA4 Antibody (3D12) - Azide and BSA Free

• CT1.4
• MAGE-41
• MAGE4A
• MAGE4B
• MAGEA4
• MAGE-X2 antigen
• MAGE-X2
• melanoma antigen family A, 4
• melanoma-associated antigen 4
• member 4

Background

This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. At least four variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MAGEA4 Antibody (H00004103-M01)(2)

Publications using H00004103-M01

• Kawada J, Wada H, Isobe M et al. Heteroclitic serological response in esophageal and prostate cancer patients after NY-ESO-1 protein vaccination. Int J Cancer. 2011-03-16 [PMID: 21413013]
• Tsai-Turton M, Santillan A, Lu D et al. p53 autoantibodies, cytokine levels and ovarian carcinogenesis. Gynecol Oncol. 2009-07-01 [PMID: 19398128] (ELISA, Human)

Bioinformatics

• Gene Symbol: MAGEA4
• Entrez:
  • 4103(Human)
• OMIM:
  • 300175(Human)
• Uniprot:
  • NP_002353()